CAZyme Information: MGYG000000294_00867

Basic Information

• Species: Phascolarctobacterium_A sp900544885
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900544885
• CAZyme ID: MGYG000000294_00867
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		38765.8	8.6026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000294	1781860	MAG	Sweden	Europe

• Gene Location: Start: 5500; End: 6486 Strand: -

Full Sequence      

MFKPEEFAKNQFILKKQKFNYTADKSAVKVMHVAFNVDDNFFMQAGVAITSILVNNPGKD
FCFHIFCDGVGDFNLEKMRQTAEKYHTQVIIYYMDMQPFQTFHIKTQHFSRVTYLRSVMP
KILKPLTEKYLYMDADMVCTGDITEIENIDLEGYPFAAASETPEAVKYKTTFLHQKSGKH
FNDGLMWIDIAEWEKEKITEKIFSYQGADPSRFSGQSQDIMNLVLDGEIKFIDRRYNGGS
ENGVLIYHFCGRNKPWQMAISEPERIWRHYLDLSVWKSIKDPNPPKVPKHYFNYKRMMIY
RRQQGHYLQMLYCLFWYTVLKVCYKLGI

Enzyme Prediction     

No EC number prediction in MGYG000000294_00867.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	11	257	9.1e-51	0.9494163424124513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	8.46e-61	31	257	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	2.06e-45	31	295	3	286	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	5.15e-43	32	256	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
PRK15171	PRK15171	2.25e-41	7	317	3	329	lipopolysaccharide 3-alpha-galactosyltransferase.
cd06429	GT8_like_1	5.29e-16	39	272	8	257	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNP77238.1	3.19e-106	1	326	1	333
ADB46899.1	8.72e-100	5	326	8	330
AVO28112.1	1.94e-98	2	326	5	329
ALG42580.1	6.30e-97	2	326	5	329
AXL22112.1	1.09e-95	7	326	12	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GVW_A	2.15e-13	105	289	79	277	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	1.69e-12	105	289	79	277	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27129	1.44e-33	23	308	20	321	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19816	1.06e-28	19	295	17	318	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P19817	2.00e-28	30	309	25	320	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P25148	1.08e-25	29	282	5	282	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P43974	2.16e-23	29	261	37	283	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000294_00867.