CAZyme Information: MGYG000000294_01332

Basic Information

• Species: Phascolarctobacterium_A sp900544885
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900544885
• CAZyme ID: MGYG000000294_01332
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000000294_40|CGC1	30545.1	5.0051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000294	1781860	MAG	Sweden	Europe

• Gene Location: Start: 11916; End: 12740 Strand: +

Full Sequence      

MYKMLGLAITIFLCMVVYDNVRDTSQPTAPVQKQEEKMSRHEKAAVASLFFSMLPPKEEW
PSPIYKFYIAFNMDDVIEPIRQKPDWTSLDTMSRDIPKALIAIEDHDFYNHGAIAIDGIL
RATLVNLSAGEVVQGGSTLTQQFVKNVFLSHEQSMERKIEEAILSLMLEDNYSKDEILEL
YLNTTYLGAGSTGIKQASQTYFGKAPSALTLAEAAVIASLPYAPTALNPLENPQGCKKRQ
LLVLNAMHKYGLINKDQLAEAKDETVYLTNGTSL

Enzyme Prediction     

No EC number prediction in MGYG000000294_01332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	81	248	9.2e-63	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.37e-79	81	248	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.47e-76	86	274	4	194	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.12e-72	67	273	56	266	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	5.06e-67	78	266	61	249	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	5.86e-47	88	264	70	246	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77901.1	2.38e-156	1	272	1	272
QNP76977.1	2.24e-88	22	273	27	275
BBG64464.1	6.37e-88	39	273	43	275
ADB46989.1	2.64e-66	36	264	27	259
AEQ23280.1	5.35e-61	61	268	48	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	8.80e-47	82	261	18	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.50e-46	82	261	18	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.77e-36	95	266	46	221	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	2.94e-33	95	266	47	222	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3DWK_A	6.74e-33	94	262	33	205	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	5.81e-43	75	257	38	219	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O66874	4.49e-42	82	261	61	240	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
O87626	1.14e-41	82	267	66	251	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q92G78	5.00e-38	89	268	72	254	Penicillin-binding protein 1A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=mrcA PE=3 SV=1
P39793	7.86e-38	72	266	83	278	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.970662	0.028885	0.000182	0.000078	0.000068	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000294_01332.