CAZyme Information: MGYG000000295_01085

Basic Information

• Species: Clostridium_E sporosphaeroides
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_E; Clostridium_E sporosphaeroides
• CAZyme ID: MGYG000000295_01085
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		39720.92	6.055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000295	2812533	MAG	Sweden	Europe

• Gene Location: Start: 11566; End: 12585 Strand: +

Full Sequence      

MREADQIIVTDTGSTDNTVQRLRERGAVVYEEVVRPWRFDRARNLSLSHVPENADICVCT
DLDEVLSPGWRAALERAWQPNTTRAKYLYNWSHHADGSPDLQLYYTKIHSRRGFFWNYPV
HEYLAYTGPVPEHVVFVEDMVLDHYPDPIKSRGSYLSLLETAVEENPTDTRMLYYLGREY
MYKKQWQSCIDTMKRYLALSQWEEERSAAMRWGAYSWNMQGKPWEAARWYLRAIAEAPQM
RDPYVEFAQMAYQQENWPLVYCLTRQALSISEKSKNFANMGYAWDHTPEDLCAIACWNLK
LTEEALEHARRAVELTPGNERLKKNLQLILTAMGKAPPD

Enzyme Prediction     

No EC number prediction in MGYG000000295_01085.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	5.37e-16	4	186	26	219	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
COG0463	WcaA	4.86e-05	1	182	29	229	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	1.96e-04	5	70	28	95	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK13915	PRK13915	4.41e-04	5	36	63	95	putative glucosyl-3-phosphoglycerate synthase; Provisional
cd06423	CESA_like	4.89e-04	3	80	25	102	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1239995.1	9.01e-164	1	335	26	362
QAT50106.1	4.98e-148	1	329	26	356
QOX65321.1	2.99e-146	1	329	26	356
ADL06103.1	2.19e-145	1	332	25	366
QRV19781.1	2.19e-145	1	332	25	366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000295_01085.