CAZyme Information: MGYG000000295_01900

Basic Information

• Species: Clostridium_E sporosphaeroides
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_E; Clostridium_E sporosphaeroides
• CAZyme ID: MGYG000000295_01900
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		55578.74	8.6605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000295	2812533	MAG	Sweden	Europe

• Gene Location: Start: 6226; End: 7782 Strand: +

Full Sequence      

MNLIAVLSRRFRMEIAGKKHFVGGIGLKKRLGSFFLVFAMLMTLFLPAYADTYTTDFMIS
STFAQMKKGDTMQLRVYSGTTEVTQVTWASSNPAVVQVNSTGTVTALAIGQATVTATSAS
GATVSCSVSCSVNVGIPGIDVSQHRGVIDWPKVKAAGIQFAIIRTGYGNENWAKQTDTQF
ENNYKGATANGIAVGAYHYSYATNVTMAAQEAEMCLSVLKGRPLQYPVVFDVEDKVHNSL
SADQMGQIVNAFCSRIQQAGYKTAVYSYVNFYNARLTSPLVAQYDTWIAHWGVSQPNFNR
PYTMWQYAAQSIPGVNGLCDVNYSYYDYAGTAAQQPTKPTDPNVFTSSALSSYSFTDQSP
DYFYRITTADAVAPTAVSSDPNVAEVKFSQQSADGYIFHVIHKGEGQATITTTSAVTGAS
VSFTVTGNALPKVVYFTDLGSSFTLQKGQTYSLRVMPTVISGNVKFLIGNPAVLTGGTVQ
STSGGWYYPITASGSGTTPIYAQVGGRAPVLVATVTVS

Enzyme Prediction     

No EC number prediction in MGYG000000295_01900.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	139	310	8.6e-46	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.68e-80	136	325	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.38e-43	138	323	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	7.99e-35	138	323	2	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	8.17e-32	136	323	63	252	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].
pfam01183	Glyco_hydro_25	1.62e-30	139	315	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1251277.1	2.32e-177	23	517	12	505
QAT49444.1	6.43e-109	23	518	33	628
QEY33648.1	1.46e-106	23	518	20	516
QNK41523.1	1.13e-104	27	414	1	388
QEY35154.1	4.36e-78	21	400	34	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KRU_A	1.87e-17	136	322	20	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	2.01e-17	135	334	4	208	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRT_A	1.10e-16	136	322	20	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P34020	5.55e-20	138	344	3	202	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P25310	4.05e-16	135	334	81	285	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	8.28e-13	136	322	9	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.141054	0.850345	0.007597	0.000382	0.000287	0.000331

TMHMM  Annotations     

start	end
31	53