CAZyme Information: MGYG000000297_01472

Basic Information

• Species: UBA7057 sp900543675
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UBA7057; UBA7057 sp900543675
• CAZyme ID: MGYG000000297_01472
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		65491.26	9.2306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000297	1541132	MAG	Sweden	Europe

• Gene Location: Start: 2606; End: 4321 Strand: +

Full Sequence      

MKKSAKSKFKTIKSLLRDNSRKLGKIDWIIIGVMVVVYSIISFINLGSFTNPQTFLEFQY
SGEEASFTLAEAKEVSHIRMYAGPEVGSYDIFVSSDGNNYEQATTVTQNSVFAWNDFQID
KNFQYLKIISKNEGSYIGEIQLYDNYGNKIELTAESETAKLLIDEKDTVPATISYLNSTY
FDEIYFARSAYEYVHGIPTVEWVHPPLGKLIMAIPVLLFGMSTFAYRLMGNIAGILMIPV
IYALAKNIFKNRKWAILAGLLMMFDCFHFAQTRMGTVDSFLVLFIMLSALFMYKYIVLEN
DAKLKTKLVNLFLSGLFIGCAIATKWTGFYAGLALAIVFFANIIYRNVGKGKEKDKDLGK
IILSCFVFFVGIPLLIYVLSYLLFPIVYPGKVEGISGLIKQTQDMYTYHSTLEATHPFTS
EWYTWPAMVKPVWYYVGYFGGGMKGTIVGIGNPAIWWFGIIASIFVLIMALLRRKREDWF
ILVFILATWLPYVFIGRIMFMYHYFPTLPFIMLAIVALIKFITEKIRNNSVYLFYVGVVI
LLFTYFYPVISGMITSEKYIETIRWLSSWYF

Enzyme Prediction     

No EC number prediction in MGYG000000297_01472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	173	383	3.3e-54	0.9282511210762332

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.07e-23	405	567	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	6.87e-21	173	388	42	272	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	4.73e-20	385	571	489	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	7.79e-18	171	383	13	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	7.40e-15	203	342	1	132	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH68061.1	2.80e-153	34	570	22	557
ADZ82369.1	1.02e-152	34	570	19	554
QGQ95357.1	2.70e-115	22	571	688	1279
QUI22495.1	6.23e-112	27	571	406	969
AIQ72362.1	3.99e-110	22	571	2	592

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.01e-24	181	569	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.64e-19	203	569	98	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	5.18e-19	181	569	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	5.18e-19	181	569	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
O42933	4.60e-07	181	337	85	258	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999992	0.000034	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
28	50
223	245
279	298
318	340
361	383
453	472
479	501
505	522
529	551