CAZyme Information: MGYG000000298_00615

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus
• CAZyme ID: MGYG000000298_00615
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22734.95	8.1409

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000298	1627980	MAG	Sweden	Europe

• Gene Location: Start: 3023; End: 3625 Strand: -

Full Sequence      

MFKFIRRMLVLAVFLFAGYKAYLIRQDVKQVMTYQPMVREILNERDTPANEELVLAMIYT
ETKGKEGDVMQSSESASGSTDTINDNASSIRQGVQTLTENLYLAQEKGVDVWTAIQAYNF
GPAYIDFIAQNGKKNTLVLAKQYSRDTVAPTLGNTTGKTYRYINPISIFQGGELYVDGGN
YYYSRQVQVNLYIMKIFNLF

Enzyme Prediction     

No EC number prediction in MGYG000000298_00615.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	6.51e-82	28	191	1	165	Lysozyme-like.
cd16891	CwlT-like	2.69e-63	34	188	1	147	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	1.46e-08	1	199	93	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF55610.1	1.78e-135	1	200	1	200
VTS70726.1	9.31e-122	1	200	1	200
QLL95816.1	3.79e-121	1	200	1	200
AEL10464.1	4.36e-121	1	200	1	200
ALD68078.1	6.19e-121	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	2.59e-17	30	196	23	182	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	2.58e-16	30	187	25	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	1.96e-118	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	3.96e-118	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
P0DC90	1.15e-69	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	1.15e-69	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	1.63e-69	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.889036	0.074989	0.034427	0.000344	0.000199	0.001011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000298_00615.