CAZyme Information: MGYG000000299_01389

Basic Information

• Species: Pauljensenia sp900541895
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp900541895
• CAZyme ID: MGYG000000299_01389
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		32702.79	8.3748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000299	1835106	MAG	Sweden	Europe

• Gene Location: Start: 9045; End: 9950 Strand: -

Full Sequence      

MLWLTGSLDYRYSRVVVDKLREFMRSWRPDVVYSEFNLAAVIAARAEGIPCVGSGSQPTT
LSYASNPRKSAGIRRLLREMGMPVPASSLSILEGMKRRFIPSCPTLEPRAGERAIYCGFL
GDVPKMDVRSANRDCAVVYLGSGSVPAGVVMRVGRQLSSALGCDVYVAGVPEAVQVVGGH
EVTCAPRLNFGELLPHARVMVHHGGQNSMMDALAYEVPQVVVPGRVFERQFNAEAVERTR
CGLSVRAPKPALIAEAALRLVDEPALTSGIRGVRDELSELGGTERIVREVEKLLDARPVN
D

Enzyme Prediction     

No EC number prediction in MGYG000000299_01389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	39	294	6.6e-25	0.6832460732984293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	7.34e-23	1	298	67	403	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	3.20e-16	17	293	89	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR00661	MJ1255	1.75e-07	14	253	83	305	conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT36430.1	2.84e-163	1	294	85	376
QGS11935.1	7.30e-159	1	294	85	376
AHF25143.1	7.79e-79	1	291	105	402
BAR06867.1	4.45e-63	1	294	93	383
BAR05900.1	5.20e-60	1	295	121	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	2.56e-17	16	288	118	401	CrystalStructure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
4AMB_A	1.22e-12	11	280	111	385	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	1.22e-12	11	280	111	385	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4RIE_A	7.82e-09	17	295	96	374	LandomycinGlycosyltransferase LanGT2 [Streptomyces cyanogenus],4RIE_B Landomycin Glycosyltransferase LanGT2 [Streptomyces cyanogenus],4RIF_A Landomycin Glycosyltransferase LanGT2, carbasugar substrate complex [Streptomyces cyanogenus],4RIF_B Landomycin Glycosyltransferase LanGT2, carbasugar substrate complex [Streptomyces cyanogenus]
6KQW_A	7.96e-09	192	294	282	385	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F2F9	1.64e-10	4	280	87	359	Elloramycin glycosyltransferase ElmGT OS=Streptomyces olivaceus OX=47716 GN=elmGT PE=1 SV=2
Q9L555	2.01e-08	83	293	217	422	Aclacinomycin-T 2-deoxy-L-fucose transferase OS=Streptomyces galilaeus OX=33899 GN=aknK PE=1 SV=1
O34539	4.41e-08	192	294	282	385	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q53685	2.04e-06	133	301	251	410	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1
Q9L9F5	2.50e-06	20	245	94	322	L-demethylnoviosyl transferase OS=Streptomyces niveus OX=193462 GN=novM PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000299_01389.