CAZyme Information: MGYG000000299_01632

Basic Information

• Species: Pauljensenia sp900541895
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp900541895
• CAZyme ID: MGYG000000299_01632
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		66537.84	6.8585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000299	1835106	MAG	Sweden	Europe

• Gene Location: Start: 3488; End: 5281 Strand: +

Full Sequence      

MDDKTLSDSDIPEDPALGSDQASPVARPEPLPEAEEGEPSPSTKVNEASAEANKASADDE
EADAAPEGTGREWKPVPIPRWARFPMSAQAGWVATLVTTLVAALIRLPGLGTIKTLVFDE
TYYVKDAYSLMTLGYEGSWAKDNDPMFIAGDYSGLSTNGGYVVHPSVGKWLISLGMRVFG
ATNPVGWRISAAIAGIILVFLTARIAQHLFRSPAITALAGFFMATDGIAIVLSRTGLLDV
FLAMFAAAAFLAVLKDQEISHPRLVEKLSQWKPDPDNPSRIGPHAGARWWLLVAGILCGL
AMSVKWSGLYALAVLGLFVAFRDWMTRRRFGHPRAFYATLINDTSVAFLAMVPPAVITYV
ASWFGWFRHWNAYGHKTHGFIGAFRDLWDYHVGMLKFHTGLTTPHTYQAHPAQWFVQARP
TSFAWNKIADASCDKSDCVNAVVALGNPLLWWFAAIAFFIVLFVTLRDRNWRTGFVVCGY
LAMYFPWYLNANRTIFNFYTIAFVPFVCLSAAWVIGLMLDQTRCEVDPDRMYASQPLEEG
DYRWMGANVVARQRFAIGAVVIVLLITAVSIFFMPLWRGDLISYNFWHIHMWFPTWI

Enzyme Prediction     

No EC number prediction in MGYG000000299_01632.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	98	367	2.1e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.59e-15	74	324	8	228	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	3.29e-15	385	594	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	2.84e-11	164	507	136	401	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	8.47e-11	99	324	4	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	6.59e-10	99	404	14	269	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKU65332.1	2.26e-184	81	597	61	584
QQC43974.1	3.20e-184	81	597	61	584
QCT34948.1	4.10e-184	77	597	54	581
QGS11599.1	1.88e-182	63	597	40	581
QUB99879.1	1.72e-134	36	597	32	587

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	1.05e-70	85	596	31	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.48e-63	85	596	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.48e-63	85	596	37	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	3.97e-59	92	596	38	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
88	110
184	206
210	232
237	254
289	321
345	367
449	466
473	490
495	517
555	577