CAZyme Information: MGYG000000299_01644

Basic Information

• Species: Pauljensenia sp900541895
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp900541895
• CAZyme ID: MGYG000000299_01644
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		80120.2	5.0621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000299	1835106	MAG	Sweden	Europe

• Gene Location: Start: 523; End: 2667 Strand: +

Full Sequence      

MKRRKIVGAVGAAAVIAMVPSLGGNTAVAAGDDTTYGASFPYTRYEAERGRLDRAHVVSL
DESQLVNTMLDSTAIEAGEQSYVELEGKDSSVSFTAEVPGNAIDLRFTLPDHAAGSVDIR
VNGETAATFNLSSETAYQYVQKSKVFDEEWQKDPGNGPAHARFLFDEVHGLLNRQVNPGD
TVSVVRMGGEGYVYGIDFVELEQALPEIQRPANSVSVTDDDLTVTEEKSPGVWETRKVYA
RPNDGQDDSDAFLAALKRASDENKTLYIPRGTFEFDRQLVVRHSPNDNHQLTVQGAGIWY
TNVFFRNPNKASGGIVLEHTSHDLQFRDFYMSTNLKSRYDEGANYKGFQGVTKNSQFINL
WIEHFECGFWMGDYVNEKQMQYTEHMLVDHSRIRNNFADGLNYSQGSRDSAVRNSNIRGN
GDDGLASWSSHAQSLPGESVQYVSNARHTDNIEFTHNTIELGWRAGGIGFFGGSGQKAEN
NLITGNFEGAGIRLNTVFGGHNFDWNLKLNKRASIQRNKIVRSGTQDDYYGGHRGAIDFQ
EVQVNGRIAGVDLYDNIIVRPFAEDVRSDFAFNSEEMKLRGMSIGSNPRRDWDGYEPQHL
VVNYARVNGKVDRGIPEDANYSLYWWDGDWVNPVDGKTHRYWIPKADGVQINDAMDFSWE
GNKKVYNFILGDDPQYLPTSSTRFLDDYTYQGEMARSFQNSSQPQTVIRFWSHK

Enzyme Prediction     

No EC number prediction in MGYG000000299_01644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	35	579	1.6e-119	0.7772194304857621

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	9.26e-29	37	201	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT35009.1	1.44e-223	1	714	1	665
ARI57509.1	3.10e-132	36	566	140	623
CCB93603.1	5.35e-132	36	566	140	623
ARC34101.1	5.70e-132	36	566	139	622
QGU80350.1	3.12e-131	35	566	139	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	4.46e-109	37	540	13	478	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	9.52e-31	35	558	52	494	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	9.80e-25	37	502	14	423	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	9.57e-24	37	502	14	423	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	9.57e-24	37	502	14	423	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000343	0.998759	0.000207	0.000270	0.000227	0.000178

TMHMM  Annotations     

start	end
7	29