CAZyme Information: MGYG000000300_00658

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427
• CAZyme ID: MGYG000000300_00658
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		85675.15	4.8763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000300	1294904	MAG	Sweden	Europe

• Gene Location: Start: 1062; End: 3401 Strand: -

Full Sequence      

MNVSFKTVRRCGDKAYVLSEITGYDGCSPVVLSASTDAGVRIPSATFPYCDVSDKLALQR
VLSGASSFSGAALDARSRSVGEPRQIIVVLPWLEVKRWELEFRAVDDEGSVVASCRKTLD
VRTTNFMAFAGEYTSAVTGEAIERLDEHYIHDRIHVSFLSVIDRGDDVLVSASVEMPYRK
EASVEFDFLDARGNRIDLEPTVVTELVTTMGDGISSTRRRMTISFVVSGANPRLCLCATD
AAGTVAPGFAMLGTRTLEDLSRRFIERTTSAYDDPSYHEWYVKQHRADLPTLLEQASTRF
ANEPLFSFVCVLSDVPFHHVHDFTTSIAQQSYGRWELILVDMMGDHDLVSSIKESLGDER
VYAIEVDPGNSIDDAFNVGMGAAEGDFVVIVAPCSMLSPDMLFSCVKELNIFSDSDVFYS
DVDTVDAEGTHLHPILRPAFSPELLRSYNYIRDLLVVRSSLLGDMFPLAFAPLGQAGYDF
ILRVTEKARRVVHVPRVLCHRRFATEEAFGALCSGHDQEMGRKALVAHCKRKGIHAEVLA
TDQPDHYRVRHVLVDAPHVVIVVLALSGDCALLSTCIRALYGMVSYRDFEVVVVEASASC
ASGASRAPGLEERYENLSVLTWEGEADRVKMANFAASQTQGEFLLFLNDDTRITTPEALE
VFLGYFQSNDVGVVGPKQLFVDGTIEHAGIVVGGSRVVTPLFRHMDSSWHGYLDRASVAQ
NVSAVTGDCMMVRRSVLDEVGGFDESFSLFYADVDLCLRAREKGLTCASVASIASLASR

Enzyme Prediction     

No EC number prediction in MGYG000000300_00658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	559	770	3e-18	0.8695652173913043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.12e-39	304	502	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.79e-20	572	770	11	157	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.28e-18	634	767	78	209	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	6.45e-10	326	502	19	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	2.04e-09	641	764	88	198	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	3.98e-124	1	764	1	763
ACV56016.1	1.22e-92	77	765	36	726
QOY61387.1	8.83e-91	53	762	27	738
ATP53720.1	2.27e-87	87	762	75	752
AZH69456.1	4.34e-86	81	762	69	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	4.73e-54	277	765	293	780	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	1.20e-44	283	764	346	832	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000300_00658.