CAZyme Information: MGYG000000303_01084

Basic Information

• Species: Varibaculum cambriense_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Varibaculum; Varibaculum cambriense_A
• CAZyme ID: MGYG000000303_01084
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
257	MGYG000000303_14|CGC1	28916.75	4.3012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000303	2213433	MAG	Sweden	Europe

• Gene Location: Start: 21; End: 794 Strand: +

Full Sequence      

MGPGVAAAAKMGGALRIDHIMGLLRLWWIPEGMLPKDGTYVRYNHQAMVGVLLLEAYRNN
LVVVGEDLGTVEPWVRDYLRYRGILGTGVLFFEFDAPDHLVPPEDYRREQLAAVNTHDMP
PVAGYLTGEDLRIRESLDLLDSTREEAEANQERVFGAVRRALIEHAGLAEDERDMGEIIR
ALYRYVAATPAQLVVLTLADAVQEQLTENQPGTEFEYPNWCVPLRDQEGNTRFLEDVTAD
QFANQLLEMLEEAVHPA

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	6	228	7.9e-55	0.4048582995951417

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1640	MalQ	1.05e-52	13	257	298	519	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14507	PRK14507	1.69e-51	13	220	476	693	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	2.69e-51	5	225	264	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK11052	malQ	1.58e-49	13	253	445	688	4-alpha-glucanotransferase; Provisional
PRK14510	PRK14510	9.72e-40	5	252	1014	1216	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBX08186.1	8.75e-80	5	256	455	707
QTE25163.1	9.46e-80	5	255	458	709
QFU97785.1	1.90e-79	13	256	471	713
QVI67109.1	2.32e-79	13	250	506	738
VEG55542.1	2.66e-79	5	256	460	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B68_A	7.80e-58	13	246	455	699	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	8.16e-34	13	251	443	684	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	2.94e-31	13	251	443	684	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P65337	2.06e-76	5	253	463	716	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	2.06e-76	5	253	463	716	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	2.06e-76	5	253	463	716	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P15977	4.45e-33	13	251	443	684	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	3.00e-30	13	224	455	673	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000303_01084.