CAZyme Information: MGYG000000303_01553

Basic Information

• Species: Varibaculum cambriense_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Varibaculum; Varibaculum cambriense_A
• CAZyme ID: MGYG000000303_01553
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		66128.93	9.8242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000303	2213433	MAG	Sweden	Europe

• Gene Location: Start: 7084; End: 8853 Strand: +

Full Sequence      

MPYPDNIEYMQAMPGRPAPPPPAAARKTLTTSDKVKPKSRRRRPPAPSWTSVTSLPRLYL
RGWRGRRDKEVIDNQRSWIVTVIACVVAAITRLPRLGATRKLIFDETYYVKDAYSLWHFG
YETNWPKGGDVKFAAGDFAAATADPAFVVHPPLGKWIIGLGMKLFGWSNPFGWRIAAAIC
GIILVYLTCRLAWALFDSWILTGIAGIFIATDGVAISLSRVGLLDGILAVFCLAGVLCVV
YDQLQVRRRMVRELLGAELGNDLAGVRWWLVAAGVWLGCACAVKWSGLYLLAVCGIFVFL
RDLTLRLSVLRISPSALSKQYPGIKGKQRAWLGAIVRGGLPAFAQLVLVAFGVYLLNWWN
WFTHPDAWGHGKTASAAGDSSWLDPISDYVTYMSEVMTFHTGVTSKHPYQSYPWQWLIDQ
RPTSMLFEKPHGDNGDFTVEAMSSLGNPMLWWVGVIALAVIIYCTFVRRDWRAGVILVGY
LGLWAPWLLYWYRTIFMFYMVVLTPFLALAVTYLIGLFLGLLRPYPEPLLACRDQLVAPS
RRTPDIAVSMGIALVIVILLVALFFYPVVSGMPIPYSHWGWRMWFSSWI

Enzyme Prediction     

No EC number prediction in MGYG000000303_01553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	85	362	1.1e-65	0.9865470852017937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	6.76e-17	79	298	25	223	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	2.53e-12	397	586	11	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	3.33e-11	147	315	42	213	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	2.35e-08	150	300	64	194	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG4346	COG4346	1.10e-06	150	529	136	429	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX81378.1	4.13e-146	66	589	38	547
QQT14111.1	1.07e-127	66	587	11	545
QQU09498.1	1.07e-127	66	587	11	545
ADI66786.1	1.07e-127	66	587	11	545
QCT34948.1	5.16e-120	62	589	57	581

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	3.55e-72	68	588	34	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	3.55e-72	68	588	34	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.22e-70	68	588	28	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.07e-49	77	588	37	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q5ADM9	1.45e-06	66	407	54	356	Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
170	187
194	216
221	240
334	356
448	467
474	496
500	522
547	569