CAZyme Information: MGYG000000307_00569

Basic Information

• Species: Rothia mucilaginosa
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa
• CAZyme ID: MGYG000000307_00569
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		46077.89	5.7948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000307	2184222	MAG	Sweden	Europe

• Gene Location: Start: 10342; End: 11604 Strand: -

Full Sequence      

MNSQPSSHNEQSLESMSEYAQRTSSHAAAAADSVTDTFVHRILGVPGALIGSVQVPDPRP
LSQRLSAWHYWWQAHLLDCVIDAGQRHLREGDITAAQEELHRARALLRGINVRNYGRFAN
DYFDDMAWLTLAVGRMNSFCIELTGANDVAAQDAGVALFEQLAKGFSPVGGMSWRKSKRD
FVNAAATAPTALAYARAGDPKTAAALMNWMNETLWDAERSLYIDGVNVRGNEYEYERSEF
TYNQGTALGALLSIAASGVPCEVDPAERAERLIVGIVKHMTEEVEFLSGARRRILISHGD
GDGGLFTGILVRYLGMAASSPLLSDEARALASTLVYSTARALWEGRREFDPDLPMNEYGI
DPNEIRGKALVQFSPRFTEPMSKVVKPGAPVELSAQVQAWTIFETAARLAHARYLASHGF

Enzyme Prediction     

No EC number prediction in MGYG000000307_00569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	63	351	3.4e-56	0.7513966480446927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	1.07e-43	34	407	10	368	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.35e-04	207	343	183	314	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW99112.1	1.15e-296	1	420	1	420
ATF62942.1	1.10e-294	1	420	1	420
BAI65589.1	1.15e-292	1	420	78	497
BAS19786.1	2.12e-292	1	420	1	420
BAV86349.1	1.25e-153	32	409	30	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	5.47e-27	68	343	86	349	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.27e-25	68	343	87	350	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	8.21e-25	68	343	87	350	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	7.74e-14	68	347	43	303	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000307_00569.