CAZyme Information: MGYG000000307_00987

Basic Information

• Species: Rothia mucilaginosa
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa
• CAZyme ID: MGYG000000307_00987
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor Rpf

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		23211.13	4.6894

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000307	2184222	MAG	Sweden	Europe

• Gene Location: Start: 1048; End: 1758 Strand: -

Full Sequence      

MKNTSIRRTAAALAIGGAVAATMSMPAANAVDGATWDALAQCESGGNWSINTGNGFYGGL
QFTQQSWNGVGMSGSPATATRAQQIEAGERLLAIQGWGAWPACSAKLGLYGKTGAAPTYT
EPTTTVAAQSQTQQTYTAPAAQAAPAAPAAQAAPAAVEAPAAPAAAPAVEAPVAAAPVAA
PKAAAGTYTVVPGDSLSLIAAKLGVAGGYQAIAAANTDIIYNVDLIFPGQVLTIPA

Enzyme Prediction     

No EC number prediction in MGYG000000307_00987.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06737	Transglycosylas	1.28e-31	32	103	1	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	7.40e-29	34	103	1	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
PRK11198	PRK11198	2.63e-10	188	236	98	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	1.77e-09	187	234	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	1.81e-09	188	235	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF62748.1	2.51e-123	1	236	1	256
BAS19583.1	1.17e-122	1	236	1	250
QXW98927.1	2.54e-115	1	236	1	252
BAI65360.1	3.73e-111	1	236	1	256
QQT89663.1	2.54e-87	1	236	1	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CGE_A	4.77e-25	36	106	4	74	ChainA, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_B Chain B, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_C Chain C, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_D Chain D, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_E Chain E, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis],4CGE_F Chain F, Resuscitation-promoting Factor Rpfe [Mycobacterium tuberculosis]
2N5Z_A	5.78e-25	36	109	9	82	Mycobacteriumtuberculosis: a dynamic view of the resuscitation promoting factor RpfC catalytic domain [Mycobacterium tuberculosis H37Rv]
4OW1_A	7.65e-25	36	109	6	79	ChainA, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_B Chain B, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_E Chain E, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_S Chain S, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_T Chain T, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_U Chain U, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_W Chain W, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis],4OW1_X Chain X, Resuscitation-promoting factor RpfC [Mycobacterium tuberculosis]
1XSF_A	2.59e-23	31	108	26	106	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
3EO5_A	1.36e-22	31	108	89	169	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86308	1.36e-30	4	235	12	221	Resuscitation-promoting factor Rpf OS=Micrococcus luteus OX=1270 GN=rpf PE=1 SV=2
Q6M6W5	3.83e-29	2	144	7	153	Resuscitation-promoting factor Rpf1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf1 PE=3 SV=1
H8F3N4	1.03e-24	17	109	16	110	Resuscitation-promoting factor RpfC OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfC PE=2 SV=1
Q6M6N7	1.93e-24	21	109	282	373	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
O07747	2.66e-24	17	109	52	146	Resuscitation-promoting factor RpfC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfC PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.998839	0.000184	0.000266	0.000195	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000307_00987.