CAZyme Information: MGYG000000307_01384

Basic Information

• Species: Rothia mucilaginosa
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia mucilaginosa
• CAZyme ID: MGYG000000307_01384
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000000307_81|CGC1	33526.65	4.1961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000307	2184222	MAG	Sweden	Europe

• Gene Location: Start: 1710; End: 2690 Strand: -

Full Sequence      

MDQLSTPGQAPAAFASHPVTSVTPLASDTDAGHETSTKASYQDALLFIAPPLLSAAVLGA
LSVNLHRIPSAHPLADASLLCAGAAAILITAWWFVSFICTLFYARSLRVSAHAAKPTELK
VPAIFRPRFMRRIVLTLGGTALGVGAVLAPAQATVATPSNAGVTGTEGMPQTTISAVMTT
DSMGAADSMGAADSMGTATADASPGSNADAVLSDTAPNQSATPLTLSAEVPDIPLAPEPS
EAAGSLQDRSPFFSPPRAEAGTYSYTVQAGDTLWSIAAEQLGEGTDASTIYDYTLDIYEA
NKDALGQNAELLYEGQVLQIPEQPVH

Enzyme Prediction     

No EC number prediction in MGYG000000307_01384.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	6.57e-10	265	322	98	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	1.33e-08	264	320	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	7.91e-07	265	320	2	44	Lysin motif.
COG1652	XkdP	8.16e-07	215	323	162	264	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
pfam01476	LysM	1.04e-06	265	321	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF63722.1	4.71e-177	1	326	1	305
QXW98223.1	2.44e-157	1	326	1	320
BAS20589.1	2.74e-153	1	326	1	346
VEI23440.1	2.23e-16	43	321	11	258
VEJ29802.1	2.46e-14	34	323	2	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999926	0.000083	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
44	66
81	103
133	155