CAZyme Information: MGYG000000308_00151

Basic Information

• Species: Pauljensenia sp001064145
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp001064145
• CAZyme ID: MGYG000000308_00151
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		35111.26	4.6721

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000308	1974388	MAG	Sweden	Europe

• Gene Location: Start: 2592; End: 3596 Strand: +

Full Sequence      

MKKGLGLFVVALFVLPGAALMPLAMLSESKAQTGNARGGSGRVSGVPEEYQDVVWRAGQA
CDVVSPSLIAAQADHESAHTWDPEITSPAGARGISQFMPATWATHGHDGDGDGRADITNG
ADSIYSQGLYMCELAQNVDSWLASGLVSGDRVDLTLAAYNAGPGAVRSWGGIPPFKETQG
YVKSIREAQDSFVETVISAPSGDGTLLAQARTHLGTPYVWGGETSAGVDCSGLIVLSYAE
LGHPFPASVRTADQITKYSDAAPIARDQLVVGDMIGFSHTPGGYVDHIGVYAGTDAVGHP
IMVHAPDVGGVVEETRLDTPYWQGMTWWPTRRAV

Enzyme Prediction     

No EC number prediction in MGYG000000308_00151.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	193	3.9e-26	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	2.88e-28	64	191	3	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.15e-24	66	189	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.60e-20	47	185	3	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam00877	NLPC_P60	1.33e-17	215	323	1	97	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
cd16896	LT_Slt70-like	9.21e-17	47	190	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT86054.1	8.32e-90	19	327	11	308
VEG28534.1	2.58e-69	46	317	271	522
CED91304.1	1.32e-68	14	293	9	291
VEG29992.1	1.00e-63	14	319	4	306
VEI18427.1	3.42e-62	46	315	42	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XCM_A	2.96e-08	203	323	114	221	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
1QSA_A	7.90e-08	47	185	450	591	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
7CFL_A	1.25e-06	202	305	13	109	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
1SLY_A	1.36e-06	47	185	450	591	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
6B8C_A	1.54e-06	206	313	31	127	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76190	6.66e-13	213	323	151	255	Murein DD-endopeptidase MepH OS=Escherichia coli (strain K12) OX=83333 GN=mepH PE=1 SV=1
O31976	1.87e-12	64	185	1435	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.87e-12	64	185	1435	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	1.81e-11	64	185	73	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
Q8NNK6	9.89e-09	143	318	36	199	Probable endopeptidase Cgl2188 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl2188 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004216	0.994598	0.000298	0.000404	0.000246	0.000209

TMHMM  Annotations     

start	end
5	27