CAZyme Information: MGYG000000309_01569

Basic Information

• Species: Collinsella sp900755685
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900755685
• CAZyme ID: MGYG000000309_01569
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		38221.8	6.4829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000309	2008488	MAG	Sweden	Europe

• Gene Location: Start: 6750; End: 7769 Strand: -

Full Sequence      

MPSTLPAPIDKLAIVVVTYKRQELLANLFDSMTELTAAPWRIVIVDNENSRETEAMCSAF
NERLANLWGIDTEQPDAQGGTDRVIYAPQLENGGGAGGFSAGTKCAYDLGAQWFWVMDDD
VLVIPEGIERLAKWTDRYDVIQGSRLDFDGGAFFWQYQLILSLGIPNPIAKWDLGPEGYR
AMNQLCFEGGMFSRRVVDKIGLPDARFFIYGDDACYGYVASQHFPAAVVADVVLKRARAV
SNWDIAGKRQLNSTSDTNRYYIMRNRGFLARYMQIYGDYHPMLFRLGNAATFCKEFIRLA
AVDKCFKTGIPALRRGMKDARKIIKDPNWKPMPPMKDTE

Enzyme Prediction     

No EC number prediction in MGYG000000309_01569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	166	1.9e-17	0.7823529411764706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	9.74e-43	15	269	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.43e-12	10	328	3	298	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.47e-10	14	178	2	148	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	3.03e-09	10	252	2	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd02526	GT2_RfbF_like	7.18e-07	15	270	2	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33439.1	5.64e-256	1	339	1	339
ATP53743.1	8.32e-256	1	339	1	339
AZH69429.1	2.30e-255	1	339	1	339
BAF39739.1	2.00e-154	8	336	10	337
AVT45485.1	2.32e-153	9	336	11	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	3.87e-13	15	269	10	254	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	5.25e-10	15	269	8	251	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	5.25e-10	15	269	8	251	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000309_01569.