CAZyme Information: MGYG000000310_00641

Basic Information

• Species: Phascolarctobacterium_A sp900552855
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900552855
• CAZyme ID: MGYG000000310_00641
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		32064.62	4.6635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000310	1785527	MAG	Sweden	Europe

• Gene Location: Start: 555; End: 1415 Strand: -

Full Sequence      

MVKTIIMALLIFAGMVGYDSFVKEDQPSLPPIKQEQQQGSSQGNEQDNKEDKHKEKAVKA
IFFALLPPQEEWPEPMQKFYIAMNLDEYIDPIRQRPDWTPLSSMSQDVPRALIAIEDHDF
YNHDGVALTSIARAFLINMSAGEVLQGGSTLTQQLVKNVLLTDEQSMERKVYEAILSLVM
ESEYSKDEILELYLNTTYFGAGANGIHDASRLYFGKAPSALTLAEAAVIASLPYAPSALN
PLENPHECKKRQQLVLKEMLRYGYINQGQQAEAKMQVITLTNGTTM

Enzyme Prediction     

No EC number prediction in MGYG000000310_00641.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	93	259	1.5e-63	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	5.24e-80	93	260	10	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.56e-76	98	280	4	186	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.84e-72	57	285	39	266	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.41e-70	92	281	63	252	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	9.91e-52	106	267	153	322	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV77901.1	1.40e-123	1	286	1	274
BBG64464.1	8.29e-79	59	285	47	275
QNP76977.1	8.29e-79	59	285	47	275
ADB46989.1	6.70e-56	57	273	36	256
AEQ23280.1	4.09e-55	73	280	48	255

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.54e-46	94	273	18	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	7.06e-46	94	273	18	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.88e-37	99	267	40	210	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	5.11e-33	98	267	158	331	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	5.25e-33	98	267	179	352	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	8.55e-46	93	280	44	230	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O66874	6.44e-42	94	280	61	247	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q1RKC5	1.04e-40	94	280	65	254	Penicillin-binding protein 1A OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=mrcA PE=3 SV=1
Q92G78	6.72e-40	94	280	65	254	Penicillin-binding protein 1A OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=mrcA PE=3 SV=1
Q4UK08	1.25e-39	94	280	65	254	Penicillin-binding protein 1A OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.738465	0.253502	0.007004	0.000242	0.000253	0.000536

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000310_00641.