CAZyme Information: MGYG000000310_00746

Basic Information

• Species: Phascolarctobacterium_A sp900552855
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900552855
• CAZyme ID: MGYG000000310_00746
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000000310_35|CGC1	61544.9	9.4557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000310	1785527	MAG	Sweden	Europe

• Gene Location: Start: 10148; End: 11740 Strand: +

Full Sequence      

MHRKYWVLLLFMALLLLFAGNDSLLITDNVEANYALTAKEMVLSNDWLSPQIYGHYWFDK
PIFFYWLTALGFKIFGFTEFGARFFPALLGLGGLALAAYGGKRLYNERTGWLSGFVLLTS
LEFFLISKSIITDAALFLFFSATLLFFYLGYRDGLARDWYLMYASSALAVLTKGPIGVLL
PGLVIIIFLLWKQDWQIIKRCKLFTGLSLFLLLAMPWYIAMYQLHGENFINMFFGVHNYL
RATVSEHPRDNVIYYYTLVNLLALFPWSFLLPWVLWKKHREGKWHLADRELFLIIWSVTI
FVFFQCMATKYITYTYPLLFPMAIVIAHLLDKYGDNGCNNIYRTCIGGFFALVLTAAWIL
GNKEVLELRELYLLPLSLIVGTICYRLLDLAGRSKMVGIGILCWCFYLALIYSVAISLTE
KRSAKDLGILLQQDEAKIVCTYGSYPTSAVFYSNKLLYRLVNKNSVYSYLPRKMSWSSKN
VMPYKILESKEYNQVVVKNKYFNEFKRQNKEQWSVVGSVQDWMLLEKKKC

Enzyme Prediction     

No EC number prediction in MGYG000000310_00746.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	512	3e-109	0.975925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.54e-49	20	412	24	431	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.10e-26	31	380	33	391	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.17e-21	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.90e-10	28	223	29	236	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	9.95e-220	1	529	1	528
ADB46704.1	4.67e-140	1	484	1	494
AEQ23377.1	2.09e-135	1	484	1	494
AVO74995.1	3.54e-119	7	488	29	466
CCC74317.1	3.54e-119	7	488	29	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.50e-36	6	332	33	366	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.04e-29	4	491	3	474	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A4SQX1	4.20e-29	1	356	1	358	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.63e-26	31	353	30	355	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
Q3KCC9	4.50e-26	7	380	28	404	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
B4TBG8	7.21e-26	3	358	6	365	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.650848	0.340401	0.005897	0.000650	0.000567	0.001648

TMHMM  Annotations     

start	end
5	27
53	75
80	99
109	127
134	156
169	191
203	225
252	274
291	308
312	330
339	361
371	390
397	419