CAZyme Information: MGYG000000311_01038

Basic Information

• Species: Veillonella sp900550175
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp900550175
• CAZyme ID: MGYG000000311_01038
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000000311_59|CGC1	30788.25	7.1404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000311	1913729	MAG	Sweden	Europe

• Gene Location: Start: 4484; End: 5290 Strand: +

Full Sequence      

MKMFRYLRNLVVFILVMILAVFIYDGFHRVQGTDRESKAHTTVEKRIEQGEDTLSRTDRI
IRLFTFKEKVEMALNQRVNKEHWVKGDVIPEYTKNALIAIEDKRYYKHGAIDVLGIIRAF
YTNTIAGETVEGGSTITQQVVKNLFLSSKRIMSRKVEEAILASEMEHYYTKDEILTMYLN
TVYYGHNYYGIYEAAHGYFGTSPSRLTLGQSALLAALPNAPSYLDPYTNYKGAKARQKLV
LEQMVDQGMITQAEADYAYQQDLGLVDE

Enzyme Prediction     

No EC number prediction in MGYG000000311_01038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	78	245	4e-66	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.98e-86	83	245	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.74e-82	57	265	52	261	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.83e-77	83	267	4	188	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.36e-67	84	265	70	251	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	2.53e-51	79	261	43	231	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG94232.1	9.32e-183	1	268	1	268
CAB1277061.1	1.77e-171	1	268	1	268
BBU35122.1	4.36e-170	19	268	1	250
SNV01217.1	4.85e-169	1	268	1	268
ACZ25247.1	4.85e-169	1	268	1	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	3.66e-44	78	258	17	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.45e-43	78	258	17	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.19e-37	79	261	55	243	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.24e-37	79	261	19	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.28e-37	79	261	20	208	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O87626	1.29e-41	80	263	67	250	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P38050	1.14e-40	71	265	58	251	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O86088	2.15e-40	86	263	74	250	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1
O87579	2.94e-40	86	263	74	250	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	4.01e-40	86	263	74	250	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999612	0.000169	0.000163	0.000000	0.000000	0.000094

TMHMM  Annotations     

start	end
7	24