CAZyme Information: MGYG000000312_00445

Basic Information

• Species: Eisenbergiella sp900539715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900539715
• CAZyme ID: MGYG000000312_00445
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000000312_3|CGC3	35234.39	6.8233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000312	2782709	MAG	Sweden	Europe

• Gene Location: Start: 65995; End: 66906 Strand: +

Full Sequence      

MIIIEVMGGLGNQMQQYALYQKMKSLGKEAKLDVSWFFDENRQKSVLAARSLELEWFDHL
PMECCTEQEKRALLGKGGFFGKVKKKLLPGTDRHFQETGMYHPEIFELDNAYLSGFWACE
KYYADILPKLRELIVFPKQETGEAARRNRDLMERMGKEISVSLHIRRGDYLDPENVAMFG
GICTDAYYEAAVRFIRERFPEAHFYVFSDDPSYAKERYREPDFTVVDWNTGKSSLFDMQL
MSCCKHNICANSTFSFWGARLNPSKDKIMIRPAKHKNGQDVGMERMQELWEGWKLIDGEG
KSV

Enzyme Prediction     

No EC number prediction in MGYG000000312_00445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	1	279	8.5e-60	0.9347826086956522

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	4.03e-61	1	275	1	254	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
250689	pfam01531	2.37e-24	1	262	1	266	Glyco_transf_11 Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
cd11548	NodZ_like	3.77e-05	1	264	1	283	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ97415.1	3.82e-107	1	303	1	309
ADL35250.1	9.50e-103	1	303	1	309
SNX52916.1	1.55e-58	1	281	1	274
ADL35260.1	1.15e-52	1	289	1	288
AOZ97425.1	2.29e-52	1	281	1	277

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	2.35e-26	8	274	7	284	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000312_00445.