CAZyme Information: MGYG000000312_02280

Basic Information

• Species: Eisenbergiella sp900539715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900539715
• CAZyme ID: MGYG000000312_02280
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000000312_31|CGC1	72527.7	5.1714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000312	2782709	MAG	Sweden	Europe

• Gene Location: Start: 23255; End: 25183 Strand: -

Full Sequence      

MKWEYEENGFWELEDQGKRILKAYACGETPDGRRVDTRQAVLTDVRQAGNSLELFFKGEE
GIDLTERLGVTETGMAWAQCGISERDGKTIESRLLKPLVVSAPGEKSGKAAVSIWKDLWM
KMLTVPYDNTMWLRYEALPLKAGRKSYEVTALYSEETREGIVLGALDFDVWKNGLVCSAT
DANTIEARSGIADEGTHDTVSHGLVRGTQILSSRFGILYGADYRRLLEKYGDELAGEKSP
LKWEHGVPFGFNSWAGLAFNLNERRYEGSGEFIRKELMPEGYQNKGTTYINLDAGWNVMG
EERLIEQTRRLHGCGQKAGIYDAPFAFFGTDTGAEIPGVPGHRMEEILLKDEKGRFLARV
DGAIPYDVTHPLWKKMTEQKFANFVKWDYDYVKVDFMSHGGMEGCHYDKTVMTGRQAIAQ
GYTFLNGLLAEERIGRPFFISLSIAPVFPYGYGHARRISCDAFGTAQDVEYELNSQTYGW
WMNGRLYQYNDPDHIVLLRSFGMEKDSTEGEAKARYTSAAIGGTVMMLSDDYERPEARKR
ARQFACNREVNELAASQTAFIPVESAQSSASAWYTAEWNGKHYIAAFHWTEKKESLSLDM
ERAGLDEKKRYRDLWSGTEFAGEQGILKWTAEGCDALLLKEL

Enzyme Prediction     

No EC number prediction in MGYG000000312_02280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	376	619	4.6e-19	0.9563318777292577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14792	GH27	7.10e-15	248	531	2	248	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14791	GH36	3.72e-04	248	531	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK01163.1	2.10e-232	5	640	17	683
AYQ71136.1	9.28e-125	91	617	123	654
QGQ94687.1	4.00e-124	120	627	141	657
AYB43258.1	5.90e-124	82	640	121	682
ACX66631.1	2.55e-122	120	617	150	659

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000312_02280.