CAZyme Information: MGYG000000313_00023

Basic Information

• Species: Collinsella vaginalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella vaginalis
• CAZyme ID: MGYG000000313_00023
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495	MGYG000000313_2|CGC1	55417.98	4.3746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000313	1450348	MAG	Sweden	Europe

• Gene Location: Start: 2547; End: 4034 Strand: +

Full Sequence      

MSFPDGFLWGGDISAAQIEGAWDEDGKSPTEVDYMVSVDRNSAFRYGYYEMPDGTEGTMM
LFSGQLPAGAKMIIKDGVNYSNHVASDFYHHWREDLALLAEMGFKALNLTISWARIFPTG
VAGGVNQAGVEFYRNVLTECNRLGMEPIITLYKYDMPFFYISDWGGWSNRKLIDEFVEFS
RVCMTEYQGLSHHWITFNELNILKLMERSNPDVDQAARQRLYEEAHNQMVAAARVVQLGH
EIDHDNQVGCMIAGTFCYPLTPDPADVAAAQRYMRDTMFFYGDTQVRGAYPSYAKSLLAS
NGVTLEVSDEDAADLMAGKADFYAFSYYSSSCATTHADEGESGAGNMMQHGVKNPYVSAT
DWGWQIDPEGLKTALNMLSDRYPDTPLLIVENGIGAIDTLEDDGTIHDPYRIEYLRDHIA
KMGEAVDEGVNLIGYTMWSCIDLISAGTGEMRKRYGFVYVDAADDGTPQGSFKRYRKDSF
HWYKCVCESNGADLG

Enzyme Prediction     

No EC number prediction in MGYG000000313_00023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	491	3.8e-135	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.58e-177	1	493	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	6.10e-175	2	495	3	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	4.47e-169	1	494	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	2.54e-158	1	494	4	477	6-phospho-beta-glucosidase; Reviewed
pfam00232	Glyco_hydro_1	1.30e-136	2	491	4	452	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASY54796.1	5.45e-213	1	494	1	491
ARD07208.1	1.77e-207	4	494	7	493
QYN56930.1	8.39e-203	1	494	1	491
QPS13838.1	5.61e-184	1	494	1	482
QQY27341.1	5.61e-184	1	494	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	5.10e-139	3	494	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.35e-137	4	494	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.67e-137	4	494	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	2.22e-135	2	494	10	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
3PN8_A	2.52e-131	4	494	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	3.15e-141	3	494	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	4.51e-138	1	494	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	3.18e-137	3	494	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	2.84e-135	2	494	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P26206	2.41e-130	3	494	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000313_00023.