CAZyme Information: MGYG000000313_00024

Basic Information

• Species: Collinsella vaginalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella vaginalis
• CAZyme ID: MGYG000000313_00024
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000000313_2|CGC1	55231.57	4.5354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000313	1450348	MAG	Sweden	Europe

• Gene Location: Start: 4087; End: 5547 Strand: +

Full Sequence      

MSFPEHFLWGGSISAAQVEGGWNEGGKSPVQIDYAGPDAGIGHRPVYYRAADGARGVMRQ
FDRLPEGARYELFDDVSYTNHDATDFYHHWREDLALFAEMGFTTFNTTVSWARIYPQGVA
GGVNREGVEFYRQVFTEARRLGMDPVITLYKYDEPIYFEETYGGWDNRAMIDEFVAFART
CFTEYRGLIDKWVTFNEINVLMMFDPENPRRIVETHNQMVASSLAVQAAHEIDPELRVGC
MIAGQCSYPYTCDPADALANQQAMQECFFYCADTMVRGRYPSWARRVQAKHGAADFTCSD
EDAAVLAVGKSDFMAFSYYSSAVVTTRELTDDEVAGNLSTSVKNPYVKASAWGWQMDPTG
FRYFLNVMNDRYDVPLFDVENGLGAVDEPVIEDGELRIHDTYRIDYLRDHIANLKAAIEE
DGINIFGYTTWGPIDLVAFTTGQIKKRYGFIYVDRHDDGTGDFARHRKDSFFWYQRVIAT
NGETLG

Enzyme Prediction     

No EC number prediction in MGYG000000313_00024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	482	5.6e-125	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	7.60e-171	2	486	3	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	5.56e-167	1	484	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	3.13e-161	1	485	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	6.56e-161	1	485	4	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	4.44e-153	1	485	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPS13838.1	4.34e-227	1	485	1	482
QQY27341.1	4.34e-227	1	485	1	482
QMW75824.1	4.34e-227	1	485	1	482
QPL19376.1	6.39e-227	1	485	1	483
QPJ28030.1	6.39e-227	1	485	1	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	7.30e-147	1	485	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	8.92e-138	2	485	10	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
6WGD_A	2.76e-136	3	485	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.20e-129	4	485	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.38e-129	4	485	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	4.00e-146	1	485	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	4.39e-140	2	485	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	8.51e-139	3	485	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	9.76e-135	1	485	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	3.44e-134	3	485	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000313_00024.