CAZyme Information: MGYG000000313_00691

Basic Information

• Species: Collinsella vaginalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella vaginalis
• CAZyme ID: MGYG000000313_00691
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495	MGYG000000313_92|CGC1	56419.93	5.0595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000313	1450348	MAG	Sweden	Europe

• Gene Location: Start: 3541; End: 5028 Strand: +

Full Sequence      

MYRNTAPIHFPNGFLWGGATAANQIEGAWDEGGKGMTVQDCLPHREVGVADFTKQFAFST
ADLDRALAADASDNYPKRRAIDFYHRYQGDIELFAEMGFRALRVSICWSRIYTDPRDPMP
NEEGIAYYLDLFKELRAHGIEPIVTLSHYDPPLALVTDFQGWYSRECIDLFVKYARTCFE
RFGGLVKYWLTFNKVDAMLRHAVTSGGLIEDRFPGLPFEQVIYQAMHHQMLASARAVKLC
HELVPDSQVGCMMTKLMFYPYTCKPEDNLAIQQRMRSIYRYVDIQVFGEYPRYLLTAIER
KGFSIESRPEDADILRAGTVDFVSFSYYMTSCMAADTDGLDMAPGNTVNGVKNPYLPSSE
WGWQTDPTGLRISLVELYDRYRKPLLIVENGLGAKDTVEADGRVHDPYRIEYLAEHVRAM
SDAINVDGVDLIGYTWWGCIDLVSESTRQMSKRYGFIYVDMDDCGNGTFERIKKDGFEYY
RQIIASNGEHASTGA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	9	488	9.8e-140	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	10	489	4	474	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	10	489	4	471	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	10	489	4	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	10	489	6	475	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.34e-171	10	489	6	475	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM11135.1	7.08e-301	1	490	1	490
QJA04125.1	1.40e-295	1	489	1	489
QQR25333.1	2.83e-295	1	489	1	489
ASU20716.1	2.83e-295	1	489	1	489
ANU70797.1	2.83e-295	1	489	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.66e-163	10	489	8	467	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	4.03e-159	8	489	6	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4IPL_A	9.03e-155	10	489	20	483	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	1.64e-153	4	489	1	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.66e-153	4	489	1	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	3.12e-177	10	489	4	471	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	2.45e-170	10	489	8	467	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	2.51e-161	10	488	4	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	1.37e-160	8	489	5	469	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	2.73e-159	9	489	3	477	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999992	0.000051	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000313_00691.