CAZyme Information: MGYG000000313_01089

Basic Information

• Species: Collinsella vaginalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella vaginalis
• CAZyme ID: MGYG000000313_01089
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		53714.8	4.7579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000313	1450348	MAG	Sweden	Europe

• Gene Location: Start: 15; End: 1415 Strand: -

Full Sequence      

MGKHTLPEDFFFGAAMSGPQTEGAWRSGGKIENLWDTWSNEDLGDFYNRVGSYAGNDFMA
RYREDLALMASLGLTTYRTSIQWSRLLTAEGEINPEGAAWYHELFRASREAGLECFVNLY
HFDMPTFLFRRGGWERREVVEAYAHYAELAFREFGQEVRYWFTFNEPTVEPEQRYQEGVW
YPKLHDFGRARTVQYHISLAHALGVAAFRRAQAAGEVRADAKIGLINAFTPTYTREDPTP
ADLEAVRMIGGINNRWWLDLITAGHLPEDVVDTLGARGVNLPVRPDDDAILAEGVVDWLG
CNYYHPTRVQAPASDRDEYGLPRFADEYIWPEARMNESRGWEIYPQGLYDFGIDVRDNYP
GLEWFVSESGMGVMDEYKHRGEDGRIEDPYRVDFVRDHLVSVSEAIAAGSPCRGYHYWGL
IDNWSWSNAFKNRYGFVEVDLMDGYRRRLKRSADWLAEVTRTHVLD

Enzyme Prediction     

No EC number prediction in MGYG000000313_01089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	462	2.5e-124	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.10e-157	3	462	1	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	8.22e-110	5	463	4	451	Glycosyl hydrolase family 1.
TIGR03356	BGL	3.40e-106	7	455	1	425	beta-galactosidase.
PRK13511	PRK13511	1.12e-97	5	466	4	469	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	3.71e-60	5	462	3	471	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH70290.1	3.78e-284	1	466	1	466
ATP54210.1	2.54e-282	1	466	1	466
AEB07579.1	2.24e-262	1	465	1	465
BCV18986.1	2.99e-251	1	465	1	466
ACV50514.1	1.68e-245	3	466	2	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	1.87e-114	6	463	3	458	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	2.72e-114	6	463	4	459	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	5.01e-108	6	459	20	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	7.08e-108	6	459	20	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	1.76e-94	6	466	11	451	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.75e-122	3	459	6	459	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
Q1JK01	1.34e-74	5	466	4	468	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) OX=370551 GN=lacG PE=3 SV=1
Q1J9V2	1.34e-74	5	466	4	468	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) OX=370553 GN=lacG PE=3 SV=1
P50978	1.34e-74	5	466	4	468	6-phospho-beta-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=lacG PE=3 SV=2
B9DU98	3.72e-74	5	466	4	468	6-phospho-beta-galactosidase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) OX=218495 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999876	0.000153	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000313_01089.