CAZyme Information: MGYG000000315_00990

Basic Information

• Species: UMGS951 sp900547585
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS951; UMGS951 sp900547585
• CAZyme ID: MGYG000000315_00990
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000315_24|CGC1	41508.94	8.7386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000315	1984931	MAG	Sweden	Europe

• Gene Location: Start: 19258; End: 20379 Strand: +

Full Sequence      

MSESNRQKTVFITGGGTGGHIYPAIAVANALREAGCKIYYVGNPKNLEKEIAQKEGLDFL
EVDISGMPRRADFCVFKWMWKLFIATARAIGYIFKYKPDMVFGTGGYVSAPALFASVLTK
TPFATHDCDAAPGIVSKTVAPFAKFVSLAFEGSKNCVNTRKAVCFGNPIRKEFSQIDKIT
AREELNLLNKPTLLVMGGSQGAKTLNKALVYTLEDLFKEFDIQIIHQTGKKNYDGTVEML
EKVYPAYKENNNYILRPYFDRMFTPLIAADIAFTRAGSLSISELCAAGAASILVPYPYAA
ADHQRKNAREMEKYHAAIYLEDRDCNSANLYKILRDLFNSPTEITLLQEKAKSLAKPYAT
REITTEILNIINC

Enzyme Prediction     

No EC number prediction in MGYG000000315_00990.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	192	357	4.5e-45	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	3.49e-115	20	371	14	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	5.30e-107	20	364	12	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	8.61e-92	20	372	13	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.35e-85	20	367	13	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	2.60e-37	8	372	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38118.1	1.75e-125	11	372	5	364
AJQ27376.1	9.20e-74	10	371	3	368
QZY57182.1	1.78e-73	10	371	3	366
QEK11953.1	1.11e-71	10	370	3	365
ACL69665.1	3.39e-71	7	359	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	7.21e-50	7	370	2	354	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	7.66e-49	2	363	4	358	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	1.60e-37	4	370	3	353	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CWJ6	6.78e-72	7	359	1	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=murG PE=3 SV=1
Q8R9G6	2.20e-71	14	363	7	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=murG PE=3 SV=1
A4J2B1	2.76e-71	12	363	5	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=murG PE=3 SV=1
B0S0Z5	7.80e-67	10	371	3	364	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508) OX=334413 GN=murG PE=3 SV=1
Q2RK79	8.02e-67	10	371	3	368	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Moorella thermoacetica (strain ATCC 39073 / JCM 9320) OX=264732 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000315_00990.