CAZyme Information: MGYG000000315_01399

Basic Information

• Species: UMGS951 sp900547585
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS951; UMGS951 sp900547585
• CAZyme ID: MGYG000000315_01399
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000315_41|CGC1	42300.38	8.8253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000315	1984931	MAG	Sweden	Europe

• Gene Location: Start: 12703; End: 13824 Strand: +

Full Sequence      

MKKLFIVTGELSGDTHAAAVVEQIRAQGGDVEIEAIGGANLRELGVKLFVDHSKMSAMGL
NFKILFDHIRLGKRLVDYLKNEYKPDLVLLIDYGGFNLNLSKFLKKEGIKTFYYIPPQIW
ASRKWRIKTVKKNISKVLTIFPFEKAMYEKEGIDAEFVGHPLVAQLPQPANRDDFFEKYG
LDKNKKLVSIFPGSRTFELQNLMDIFLEAAKILKEKENNVQFVISQAPSIKDETFEKYFK
NSDILVIKNDNHALLSVSDALILASGTVALEAALYQTPMIISYRGPWFYYFVYRLVRCIN
RVCLPNIILDKDVVPEILQGDCKAEIIAENIHKLLTNEDERAAMIENLGHVKSMLSKHQA
AKEAANVIISALK

Enzyme Prediction     

No EC number prediction in MGYG000000315_01399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	355	4.6e-110	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.14e-124	1	373	1	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.57e-108	1	369	1	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.99e-77	4	341	1	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.03e-75	6	368	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.28e-48	1	368	1	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	5.17e-170	1	372	1	372
VEH12442.1	4.50e-82	2	372	5	379
SNV50078.1	3.53e-77	2	373	5	380
CEK10842.1	7.85e-76	2	360	5	367
ADV48241.1	7.58e-75	3	372	2	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.24e-48	6	369	11	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.14e-48	6	369	11	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	2.25e-74	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9NCA7	3.18e-74	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
A9KC41	3.18e-74	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	3.18e-74	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
B6J9H1	4.48e-74	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000315_01399.