CAZyme Information: MGYG000000316_00354

Basic Information

• Species: UBA945 sp900549675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA945; UBA945 sp900549675
• CAZyme ID: MGYG000000316_00354
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000000316_22|CGC1	88542.12	5.2786

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000316	2303090	MAG	Sweden	Europe

• Gene Location: Start: 4347; End: 6665 Strand: +

Full Sequence      

MDLSNLPKTDWFWSPSWSKTEEEKPQFLCFRKKVTLTSEMESFVIHISADSRYKLYINGS
FVETGPQKGDRNIWHYDTIDIASYLQIGENCLAVEVLRYPLEARKGNFGVIRTQTPGLYF
KIMPSDKNDSYSETQWKCLKNLQRNIVSEAEGFAPLQIMEIHAGDERLKEWQKLSFDDSS
WEEAVQYPVFAVSRTESPGNLRERTIPFLYRTAKTFSEVSCIRQSGFSSSEWENFISKRS
PLCIPSHTTEIVEFSAGEEMTAYIKLAVSGGKGTKITLLYAEAYALPHEEKSAIRYYKKD
RADSKNGVLIGFEDVYTVGGFGEKNHEEVYEPFWFRTFRFVQLKVETQAQPLVLSGLDYE
ETGYPLDVKTSVKTSDTTLEAVWDISERTLRRCMHETYEDCPFYEQLQYAMDSRSEILYT
YMTAADDRLARRCMEDFRKSQREDGLLNASAPCCVTNVIPGFSIYYILMVHDHMMFFNDP
ALVKSHQATIDRILYFFDTHLDSRGLVEKIGGLNVIAPYWSFIDWTKDWATGVPNAQKYG
SITMESFLYIMGLMAAADLAEYTGRKDTAVEYRERAEKVRNAIRRYCKGKNGLYQDGPGF
EEYSAHCQVFAVLTQTSDVAEGRRNMREVMENAEKYTACSVSMAFYLFRALEQTGLYEYT
QRLWDVWREMVKNNLTTCVEDDVNGRSDCHAWGSLILYELPAVVLGVRPASPGFETIEVN
PVPGYFNHASGEVVTPKGMVRVSWRKQKDGNLDVDYELPQGIKSVSAKKSST

Enzyme Prediction     

No EC number prediction in MGYG000000316_00354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	254	763	4e-105	0.9682539682539683
CBM67	10	187	3.5e-33	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.39e-22	371	704	5	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	7.02e-08	39	185	2	151	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.61e-07	706	759	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.16e-04	248	343	6	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	4.22e-04	49	99	135	180	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN31128.1	1.61e-278	11	765	7	764
AIW40053.1	2.81e-264	1	766	1	769
QHM38607.1	1.77e-253	3	762	1	766
ALC08600.1	2.87e-252	3	762	1	766
QBZ22885.1	1.86e-244	47	762	1	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	1.00e-40	13	762	6	935	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	2.25e-11	30	749	179	880	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000316_00354.