CAZyme Information: MGYG000000316_00971

Basic Information

• Species: UBA945 sp900549675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA945; UBA945 sp900549675
• CAZyme ID: MGYG000000316_00971
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621		71175.78	4.8176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000316	2303090	MAG	Sweden	Europe

• Gene Location: Start: 3294; End: 5159 Strand: +

Full Sequence      

MSGYYLLPKPKECKWGTGTYLLQETVEIVLSSACALEVNEFARLLKEELRESLGVSVSIA
RSLTERGDIWIEQSSEMDAGEYELSITQEGVILTALQPNDLLHAVQTLRQIIRQSGTELP
FVEIKDKPDFKVRGFYHDVTRGKIPTMETLYGLIDRMSFYKLNQLQLYVEHTFAYVGHEE
IWSGAEPLTAEDILNLDEYCLKRGIELVPSFSVFGHLYHHMRSDSFKHLCELGEDQTPFA
WYNRMQHHTVDVSNTESFILAADMLDQVLPLFSSNKFNICGDETFDLGRGKSRELAEKIG
KGKLYADYLSKLIEHVENRGKRAMFWGDIILKYPEYLEHLPKNAICLNWEYGMNIPVQNV
EKIEQSGLTQYVCPGVGGWNRIINSFASSFVNIRGMAKAGYDHHAEGVLNTDWGDFGHIN
LLGGSMPGMIFGGAVSWNQEITDDECMKAISVLEYGDTGEEIMDLLYRLGKQEICNWRII
ALWYDVNKNNLLKDEYEEEKKVLEEITSEQWQTAAAHAKIIQRELTALMPRVRSDRKQDV
QEFILAAKGISLFNEITEGLITGDFSVNPSDLAQKLELWYDSYTKSWRLRNKESELARIG
EVLHFWSSHLRNEYDSDLRTV

Enzyme Prediction     

EC	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	126	438	7.8e-44	0.9673590504451038

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06565	GH20_GcnA-like	2.64e-88	132	438	1	301	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06564	GH20_DspB_LnbB-like	8.23e-19	131	362	1	234	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
COG3525	Chb	1.77e-18	4	331	134	491	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00728	Glyco_hydro_20	7.40e-18	130	349	1	239	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
pfam02838	Glyco_hydro_20b	3.25e-17	4	126	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS98665.1	6.57e-194	5	612	2	618
QAS62105.1	2.64e-176	5	611	2	614
AYE33954.1	2.64e-176	5	611	2	614
ATD58120.1	2.12e-175	5	611	2	614
SLK12840.1	2.12e-175	5	611	2	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	1.56e-12	2	349	27	405	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
6YHH_A	9.90e-12	82	349	94	383	X-rayStructure of Flavobacterium johnsoniae chitobiase (FjGH20) [Flavobacterium johnsoniae UW101],6YHH_B X-ray Structure of Flavobacterium johnsoniae chitobiase (FjGH20) [Flavobacterium johnsoniae UW101]
4C7D_A	2.45e-08	82	283	82	302	Structureand activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor],4C7D_B Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor],4C7F_A Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor],4C7F_B Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor]
4C7G_A	5.65e-08	82	283	82	302	Structureand activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2) [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UPR7	1.37e-17	6	440	113	539	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
P49008	5.39e-13	2	330	33	388	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
P13670	3.53e-08	6	169	212	370	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000316_00971.