CAZyme Information: MGYG000000316_01637

Basic Information

• Species: UBA945 sp900549675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA945; UBA945 sp900549675
• CAZyme ID: MGYG000000316_01637
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		47815.58	6.2319

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000316	2303090	MAG	Sweden	Europe

• Gene Location: Start: 2238; End: 3494 Strand: -

Full Sequence      

MPRFSKNFMIGAATAAHQVEGNNISSDCWVMEQLPHSIYKEKSLDAVDHYRHYEEDIRLL
AEAGLNAFRFSIEWARIQPEPDLWEENEIEHYRNVIKCCRKNGVEPIITMHHFSSPKWLI
QRGGWENPKTADLFASYCEYVVKKLGEDMCYVCTINEANMGLQLGKLIRNRQQMEKHNVQ
VGLNTDSMKNRMLSMKEAGEAFGVDPQKINMFLSPRTVFGDGVIIEAHRKARNAMKVACP
HLKIGLTLSLHDFQALPGGEHRAEIEWIEEFIHYLPYIDQDDFIGVQCYTRKLMGPEGVV
QPDETALRTQMGYEDYPAAVVNVTRKVAEHFQGDIIITENGISTADDNRRIEFIREVIDG
LKGCVASGIPLKGYLHWSLLDNFEWQLGFARTFGLIAVDRGTQIRYPKDSLSFLGSQR

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	413	4.8e-107	0.9673659673659674

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.86e-80	1	410	1	442	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.66e-63	3	410	4	440	Glycosyl hydrolase family 1.
PRK13511	PRK13511	6.48e-44	1	410	2	455	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	9.95e-32	1	413	1	464	6-phospho-beta-glucosidase; Reviewed
PLN02814	PLN02814	2.72e-31	4	413	28	475	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ16638.1	4.10e-175	8	415	3	414
QIZ10991.1	1.02e-174	1	415	1	423
AJG98209.1	5.45e-174	1	416	1	427
AXB29242.1	1.69e-170	1	416	1	429
QTE67958.1	1.33e-169	4	415	3	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.50e-111	4	416	7	407	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	2.65e-82	8	415	36	425	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.00e-61	3	410	10	437	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	1.07e-57	3	415	4	400	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6YN7_A	1.96e-51	4	417	8	442	ChainA, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_B Chain B, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_C Chain C, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_D Chain D, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q08638	1.04e-47	3	410	5	431	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B9K7M5	2.75e-46	1	410	1	429	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
Q03506	4.38e-45	4	410	6	435	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P0C946	1.00e-44	1	405	1	424	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1
P22073	2.21e-43	3	410	5	431	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000035	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000316_01637.