CAZyme Information: MGYG000000318_00003

Basic Information

• Species: Streptococcus infantis_I
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus infantis_I
• CAZyme ID: MGYG000000318_00003
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22678.89	8.1381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000318	1498040	MAG	Sweden	Europe

• Gene Location: Start: 3129; End: 3731 Strand: -

Full Sequence      

MFKFIRRMLVLAVFLFAGYKAYLIRQDVKQVMTYQPMVREILNEKDTPANEELVLAMIYT
ETKGKEGDVMQSSESASGSTDTINDNASSIRQGVQTLTENLYLAQEKGVDVWTAIQAYNF
GPAYIDFIAQNGKKNTIALAKQYSRDTVAPTLGNTTGKTYRYINPISIFQGGELYVDGGN
YYYSRQVQVNLYIMKIFNLF

Enzyme Prediction     

No EC number prediction in MGYG000000318_00003.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	5.85e-83	28	191	1	165	Lysozyme-like.
cd16891	CwlT-like	7.73e-64	34	188	1	147	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	4.60e-09	1	199	93	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF55610.1	6.20e-136	1	200	1	200
AEL10464.1	7.54e-122	1	200	1	200
ALD68078.1	1.07e-121	1	200	1	200
VTS70726.1	1.32e-121	1	200	1	200
QLL95816.1	5.38e-121	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.87e-17	30	196	23	182	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	1.87e-16	30	187	25	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DPY9	6.85e-119	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q9AHT6	9.74e-119	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
P0DC90	4.03e-70	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	4.03e-70	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	5.72e-70	15	200	14	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.885492	0.077393	0.035551	0.000354	0.000205	0.001008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000318_00003.