CAZyme Information: MGYG000000319_00115

Basic Information

• Species: Pygmaiobacter massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Pygmaiobacter; Pygmaiobacter massiliensis
• CAZyme ID: MGYG000000319_00115
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
707		78821.37	6.2391

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000319	2608342	MAG	Sweden	Europe

• Gene Location: Start: 3208; End: 5331 Strand: +

Full Sequence      

MNHSSSGTGSVRRLLHLLPPDVQRGISHAKRKMLGQPLSDQTLPLSAADQAAITCQARQA
KQQALQSQHQAACRTRYEATCASPFPPQKVSVIVPNYNYARFLDQRLDSILAQTYPIHEL
ILLDDASSDNSVTLLQARAAKITQFPVKVVPNDTNSGCVFAQWEKGVALATGDFFWIAEA
DDFCAPKFLETAMKPFVDDKVLLSYTDSSIVDESGTVTRAHSREMFNIFGTDRWESPYIN
EGKAEITDWLSVNNTILNASSLVWRKANYSDIFAEARSFRLAGDWYFYLQVLLRGDIAYH
PAPLNYYRMHSNVVRKTTSADIEYQEISRIQQAANTALSLPLNTLLAQRRRRAYLEPEVS
ASALKKRVAILCSPPFPGSGGHRTIIQNINALVAAGYDCDLYYDYCLDLSGCNEANARAY
TESCCGECGAEILIGKQLRTSYDLVLATVWDSAKDASLTECPHKAYFIQDYEPWFYPMGD
ERLAAEQTYRYGLTPITIGRWLAHTMETKYGTPALHFDFCADLSVYHPLPDASRRHAVCA
VYQPGKPRRCSRLLLAALRRLKELDPDAEILLYGSNEQDGAEQTIPGAENLHVLPVEELN
RLYNSCAVGLSISSSNPSRIPFEMLAAGLPVVELEVENNQFDFPKDGITLAQPDAEQLAQ
ALYSLLSQPKKARRAGEAGALYMKDYPLQKGFQQFVQAVEALLFPKS

Enzyme Prediction     

No EC number prediction in MGYG000000319_00115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	91	230	1.1e-22	0.8294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04196	GT_2_like_d	4.52e-30	91	314	1	210	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.69e-23	92	200	1	106	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	9.01e-23	91	240	1	148	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	3.29e-22	91	310	1	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	4.34e-18	89	312	4	255	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCG61264.1	1.75e-91	367	707	3	348
AYA98902.1	1.97e-89	378	703	13	334
BBE09943.1	9.12e-82	367	707	3	337
ADE16650.1	1.21e-81	368	703	4	334
QBQ53520.1	9.11e-81	368	703	4	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.39e-11	90	199	7	112	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	5.53e-10	89	183	6	96	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2X0E_A	3.08e-07	442	665	133	376	Complexstructure of WsaF with dTDP [Geobacillus stearothermophilus],2X0E_B Complex structure of WsaF with dTDP [Geobacillus stearothermophilus],2X0F_A Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus],2X0F_B Structure of WsaF in complex with dTDP-beta-L-Rha [Geobacillus stearothermophilus]
2X0D_A	1.65e-06	442	665	133	376	APOstructure of WsaF [Geobacillus stearothermophilus],2X0D_B APO structure of WsaF [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	3.38e-17	438	680	987	1234	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P22639	1.16e-11	89	212	2	122	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
Q57287	9.02e-11	90	312	7	219	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
P11290	1.07e-09	89	283	7	186	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
P71054	4.73e-09	89	190	6	105	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000319_00115.