CAZyme Information: MGYG000000319_00989

Basic Information

• Species: Pygmaiobacter massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Pygmaiobacter; Pygmaiobacter massiliensis
• CAZyme ID: MGYG000000319_00989
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		48374.69	5.9172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000319	2608342	MAG	Sweden	Europe

• Gene Location: Start: 12013; End: 13275 Strand: +

Full Sequence      

MEGFRFPENFALGAASAATQVDGDCKESNWYDWYQKGHIKDGSDPDIATMHRKYLREDTE
LMAEMGIRHYRFGIEWARIEPREGEFQESEFLKIREEIELLQSHGIAVLLTIHHFSNPIW
FEQRGAFLSADCVPIFLRFTKKVVENLGDLVSEYITINEPNVYAVSGYFGGDFPPGENSM
SKTLKVMKTLGECHRRAYEVIHKQRETMGYTDTKVGFAHHMRAFAPYQAGNPWHRLCCRI
SEKMFQTDISKTYLLGTEKDPGQYADFLAINYYARTASKGFADGTFPGAPVNDLGWEIYP
AGIAECCAKLHALLPQLPIYITENGTADNHDTFRRHYLYDHLRALCESGLPVTRYYHWCF
VDNFEWLEGFTARFGLVELNTKTMERTIKQSGEFYRQMIAYHGVSEEMAVEAEKEVYPHA

Enzyme Prediction     

No EC number prediction in MGYG000000319_00989.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	402	8.4e-100	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.06e-82	5	407	3	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	4.04e-75	4	403	3	452	Glycosyl hydrolase family 1.
PRK13511	PRK13511	3.04e-40	4	398	3	462	6-phospho-beta-galactosidase; Provisional
PLN02998	PLN02998	4.21e-29	6	399	31	485	beta-glucosidase
PLN02814	PLN02814	1.13e-26	6	395	28	476	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEC01995.1	3.38e-172	4	417	3	424
ABX42305.1	1.16e-157	4	408	3	415
AAS12396.1	2.14e-135	4	408	2	414
QOW59739.1	7.98e-133	4	408	2	414
AGT44419.1	7.98e-133	4	408	2	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	1.53e-67	5	408	4	412	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6Z1H_A	9.94e-63	5	404	10	450	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
2O9R_A	1.14e-57	4	403	10	451	ChainA, Beta-glucosidase B [Paenibacillus polymyxa]
2O9P_A	1.19e-57	4	403	12	453	ChainA, Beta-glucosidase B [Paenibacillus polymyxa],2O9T_A Chain A, Beta-glucosidase B [Paenibacillus polymyxa],2Z1S_A Chain A, Beta-glucosidase B [Paenibacillus polymyxa]
2JIE_A	3.26e-57	4	403	12	453	Beta-GlucosidaseB From Bacillus Polymyxa Complexed With 2- F-Glucose [Paenibacillus polymyxa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22505	1.56e-56	4	403	6	447	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
Q08638	5.11e-51	5	406	5	446	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P26208	1.04e-50	1	403	1	447	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	8.90e-50	6	399	5	451	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
B9K7M5	5.23e-49	5	406	3	444	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000319_00989.