CAZyme Information: MGYG000000319_01281

Basic Information

• Species: Pygmaiobacter massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Pygmaiobacter; Pygmaiobacter massiliensis
• CAZyme ID: MGYG000000319_01281
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1590		179520.89	5.2665

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000319	2608342	MAG	Sweden	Europe

• Gene Location: Start: 3174; End: 7946 Strand: +

Full Sequence      

MVVLADKENCTGCGACQAVCPYGAIQMIKSAEGFAYPQISSGKCIECGACEATCPVINIS
TPGDLLKVLAAKSKNEEERKKSSSGGIFSVLAKGVLQQGGVVYGAAFDDALAVEQVRIDT
VADLDKLRGSKYVQSDMKKVYGALKKDLNTDRSVLFVGTPCQVDGVQAFVRQQGLPAGQL
YCAALICHGVSSPGVWQDYINWQRNLYEKYPINLRFCGKEEGWHARKAIRFQTAAGKQMS
DSSFIECFLSDQILRPGCYNCHYTTPYRNADLTLGDFWGIENTSHREMDDDIGVSLILCH
TEKGEKLLNSIQDEIEQQEATVEEALANQRTLNSPFERPSNRDEFWNDYFAGGLPLVVHK
YISQDPLDAYLDAVHLTTGQRVVVLPDGTGSKGDEALLRGVLNVMKGTPNLVLLTPRKEL
WRDVVTDRTLEFTEYYVSVNQLQKQLARPLDLVVVGTDVIDGTCGLEDSLGRLKAVAAAA
KAGSTVRVFCSFRSDVKEEILEEIAGLPQTVQFYLRDMLSLENFNKLTGRKGEYFPDFAF
FCETQKSLLTEDYTAQIKEAKAGGSTVVGLNFGEPSFRSFYAEHTPAMRAKYVETVLRSI
CEEIPSARIWLISHDYRHWNGYFSDADYQNLTMQVAENIGCSERVTLIPARTSHAELLEI
LPEFDMVVTGRMHLSVASMRSGIVPIVYTGASKDGKFSMIEKVRGMLQSRLGRGDLAATS
LNQLRAALRMVNQDRETLKQTLQQNNRINMEKDSAYGAMFAPTQAKLETQQSEQILYQEM
LMRTAESIHQLREDQNTEQAIKQRLFENEKANLHGHIEQLIESERCLNAQIGNLEEQLQD
QVENTNAKIVELYQQKQALDELRNSIAGLNNQIQQLQQPMLSLNAIYASRTWRYSHKLAT
MARRVCPAGSLRARVAGAIVRVPLRFEHWVRSLPAKRRAKKEQKYYFERLAPITLPQSEE
PLVSIVIPVYNQFPFTYNCLRTIAAECAGMEYEVILADDNSTDETCRITEKVSGLIISRN
AENQRFLRNCNNAAQLARGKYVMFLNNDTEVQPEWLQSLCETIEADDSIGMVGSKLIYAN
GQLQEAGGILWADGSAWNYGHGDDPEKSEYNYVKEVDYISGCSMMIRRSLWEEIGGFDER
FVPAYCEDSDLAFEVRAHGYKVIYQPKSVVIHHEGISNGTDTSCGQKQYQIVNAKKFYEK
WQSVLEDDQFEHAKNVFCARDRSCGKPCVLFIDHYTPTYDQDAGSRTVFEYLRLFVQMGY
NVKFIPDNFYRMPKYCEALQQLGIEVLYGPEYAQHWKEWIIENKEAIKFVFTNRPHISIK
YMDFLREKTNAKIAYYGHDLHFLRELREYELTGDKTKLESSSKWKAIEFALMRKADVAYY
PSKIEQDIIHESDPSINVKVLVPYIFSEVTTPDYVLEEREDIMFLGGFNHGPNVDAALWF
AKEILPLVQEKLPKVRWHVLGSHPPKEVQALASDTIKVHGFVTDEELAEFYEDCRMSVVP
LRYGAGIKGKVVEAMKFGIPVLTTSVGAEGILGAENSLAVEDDPQAFADRLCSLYEDESA
LRAMSAASCEYIRTQYGPENAMNLIKEDFT

Enzyme Prediction     

No EC number prediction in MGYG000000319_01281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	964	1132	1.1e-24	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.14e-47	965	1174	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.69e-41	960	1179	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13692	Glyco_trans_1_4	4.63e-28	1422	1557	4	138	Glycosyl transferases group 1.
COG1215	BcsA	7.33e-27	945	1170	38	262	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd03801	GT4_PimA-like	2.37e-26	1229	1586	2	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU26503.1	1.21e-249	953	1588	429	1064
CBK78783.1	4.53e-236	866	1589	354	1085
ADL06321.1	8.13e-235	961	1589	405	1037
QRV19580.1	8.13e-235	961	1589	405	1037
QGQ98489.1	1.61e-234	950	1589	456	1095

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z86_A	4.36e-08	963	1204	95	366	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	4.36e-08	963	1204	94	365	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	1.11e-17	953	1181	566	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	2.03e-17	956	1179	620	852	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
P9WLV8	2.40e-10	960	1071	16	127	Uncharacterized protein MT1568 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1568 PE=4 SV=1
P9WLV9	2.40e-10	960	1071	16	127	Uncharacterized protein Rv1518 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1518 PE=4 SV=1
Q8MYY6	5.61e-08	955	1241	104	402	Putative polypeptide N-acetylgalactosaminyltransferase 13 OS=Drosophila melanogaster OX=7227 GN=pgant13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000319_01281.