CAZyme Information: MGYG000000322_00497

Basic Information

• Species: Odoribacter sp900544025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900544025
• CAZyme ID: MGYG000000322_00497
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42785.06	8.7715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000322	3470887	MAG	Sweden	Europe

• Gene Location: Start: 8613; End: 9728 Strand: +

Full Sequence      

MKKWIVSACILATGLVVNAQDFSAAFNKADVKKVMRSVADWQIAHQKEVKHQPLGWENAA
MYMGMLDWAELAEKEDKDGKYYKFIYNIGSKGGWQPAKRMYHADDICISQIYVDLYRRYN
RREMLNPTFARTQWVMANPPDANMKLDYSTGKGLEKWTWCDALFMAPAVYVKLYTLTGDK
KYMKFADKEFKDTYNYLYDRDEQLFYRDWRYFTQKEKNGKKVFWGRGNGWVLGGLSEILK
ELPAKDKYRKFYEDLFVELSNSVLKCQQADGFWRASMLDPESYPSPETSSTGFIVYAFAY
GVNAGILPAEKFLPAVEKGWKALVSAVEDDGKLGYVQPIGADPRHVTRDMTEVYGVGAFL
LAGNEIYKMSK

Enzyme Prediction     

No EC number prediction in MGYG000000322_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	368	3.5e-85	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.66e-98	34	369	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.34e-48	18	362	3	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74307.1	5.71e-186	1	369	1	366
QIU93494.1	6.49e-184	2	371	6	372
ASM65072.1	5.31e-183	10	371	12	372
QUU06865.1	5.31e-183	10	371	12	372
QRP56352.1	5.31e-183	10	371	12	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.34e-81	26	369	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	4.44e-61	27	365	29	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	4.45e-54	41	365	27	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	7.21e-08	159	366	141	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.93e-07	159	366	131	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.58e-80	26	369	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.27e-80	5	371	8	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.07e-74	28	371	54	413	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.95e-07	159	366	141	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000312	0.998995	0.000187	0.000171	0.000180	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000322_00497.