CAZyme Information: MGYG000000322_00738

Basic Information

• Species: Odoribacter sp900544025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900544025
• CAZyme ID: MGYG000000322_00738
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1134	MGYG000000322_10|CGC1	128306.34	7.4537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000322	3470887	MAG	Sweden	Europe

• Gene Location: Start: 62612; End: 66016 Strand: +

Full Sequence      

MKTLKTLVCGISVFCLLACPSLAQNPSFTKVAANDCGVPGAQPFLIKGENYTMPSRLQGS
KAALTCNFGGKVIYAFNHLDIHADYQLEVVYLADHERRQRIVVDGNELQAPFTLEAGKEQ
RYWIDLPRKAYAYGQLVLIFEKAGKGDNVLVSELNLYSSNPTSPVPFEGEEKRTLANAQS
YKVNTNVDVEKVLPVYALIPQSLPGTYRPAISLNGTWLFHPKPTDEFYKQTATGDWKPIT
VPGQWAMQGFQVDSASFAGYRTAFTLPADWQGRCIKLRFDGVSSEYHIYLNGHEAGYHMG
GMTAYEIDITRHLKPGTNELALAVRSESLADMLGSLTQYAAHQLGGITRKVTLFALPETH
LSDLRIETDLDNRYENATLKVTTAITNTTGKTQKNLSLRLTVAGLPGIIEKSIPQLLPGE
TWKGVLSDTILHPLLWNNERPHLYTLKLELSQNAEITEIVTKRFGFREIEIRGNELFVNG
QSVKLRGVCRHEAHPTTGRVLTEALQREDVELYRAANCNFIRTSHYPPAEEMLEICDELG
MFVELEAPVCWIGHHANENWTRLNYQDSIYYPYILQANMETIHFYRNHPSILFWSMANES
FWNREFAQIQEYVYKADPTRPHTFHDQAYGGFNNQGSNAPVANIHYPGPNGYKTAAQSDR
PMIYGEYCHLNVYNRSELVTDPGIRSDWALALSPTWENMYKTQGVLGGSIWSGIDDIFQM
PGGNAVGYGAWGPIDGWRRPKPEYWDMKKIYSPVRVHTTQLSPGHELIVEIENRYTYLNT
NELKIAYRYGEEQGFVSTSIPPKGTGKLRIPVRQSETTGELYLSFTDPRGFIADEYLIPV
GKQTQNELPAWTESPTKLKTGKDRFIVTGKNFSCEISRFSGQILSLKKNKKSSLCGGPWL
MALPLTGGGCYPNHNANTPIFNDLCSDWKATQVKARKEGNNIIISVEGSYKEFKGEYHLT
VNANGELSVSYRFDALQNINPRQWGLVFDVPRNYNNTFWRRKGLWSVYPADHISRPVGTA
PLFYAGLPEQINPRVQPSWTWNMDYNELGSNDFRATRRNIWYAGLTDKSGSKITVCSNGE
QHWRSWLDKDKIRFLIADFVTAGNEMFLESYYAPYRKPIKKGDKIEGTISLRVE

Enzyme Prediction     

No EC number prediction in MGYG000000322_00738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	207	1009	2e-131	0.9534574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	3.30e-90	213	900	44	761	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.60e-76	199	886	1	684	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	7.08e-59	212	644	54	499	beta-galactosidase.
PRK10150	PRK10150	1.92e-48	208	624	10	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	1.98e-35	469	754	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50207.1	0.0	23	1134	26	1137
QRO24898.1	0.0	17	1133	15	1123
AQT68269.1	2.17e-282	43	1131	44	1211
BBE16084.1	1.29e-278	211	1133	54	985
AOM75904.1	6.54e-247	60	1134	62	1122

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	6.75e-56	181	1039	11	911	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	4.18e-55	211	1008	39	859	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.20e-55	211	1008	40	860	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3BGA_A	1.41e-50	204	1078	39	931	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
1YQ2_A	5.87e-45	209	824	32	691	ChainA, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.30e-54	211	1008	40	860	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	2.90e-51	177	1037	23	935	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P06864	1.17e-50	211	898	42	759	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
T2KPJ7	7.42e-49	208	620	51	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P81650	7.23e-47	172	822	10	702	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000462	0.545256	0.453610	0.000289	0.000192	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000322_00738.