CAZyme Information: MGYG000000322_01738

Basic Information

• Species: Odoribacter sp900544025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900544025
• CAZyme ID: MGYG000000322_01738
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		32054.63	5.8344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000322	3470887	MAG	Sweden	Europe

• Gene Location: Start: 8068; End: 8892 Strand: -

Full Sequence      

MAKKKILFISQEIMPYLPESEMAHIGRFLPQGIQEKGKEIRTFMPRYGCINERRNQLHEV
IRLSGMNLIINDTDHPLIIKVASIQAARMQVYFIDNEDYFQRKHIVADDDGTFFPDNDER
AIFFARGVFETVKKLRWAPDLIYCQGWITALVPLYLKKEYQEDPVFAHSKIVFSTYNDQF
EGCLHKDFHKKILNDNIDAKDVSVLKEPTHTNVNKLAFDYSDGIIFNSHEIDPELKTYAQ
KTGKPLIEYSTQEQYIDEYANFFDEILESVPVKK

Enzyme Prediction     

No EC number prediction in MGYG000000322_01738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	239	1.1e-44	0.4745762711864407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	7.92e-54	6	240	1	222	Starch synthase catalytic domain.
PRK14098	PRK14098	9.24e-41	1	217	1	215	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.11e-28	5	240	1	221	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.45e-24	5	182	2	160	glycogen synthase GlgA.
COG0297	GlgA	1.37e-17	5	182	2	171	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV43872.1	5.69e-173	1	274	1	273
ADY34094.1	5.69e-173	1	274	1	273
AZS31272.1	4.50e-155	1	268	1	268
QRO49825.1	1.29e-154	1	268	1	268
QIA09804.1	1.35e-130	1	266	1	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNG_A	2.53e-07	2	188	36	231	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]
6GNF_A	5.78e-07	6	182	24	207	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.09e-38	5	199	7	202	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4SC83	5.64e-38	5	199	7	202	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
Q3B6C3	1.09e-37	5	216	7	214	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4S584	4.15e-37	5	202	7	206	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
A1BIY8	1.08e-36	5	193	7	196	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999840	0.000183	0.000016	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000322_01738.