CAZyme Information: MGYG000000322_01870

Basic Information

• Species: Odoribacter sp900544025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900544025
• CAZyme ID: MGYG000000322_01870
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
926		105262.97	6.9267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000322	3470887	MAG	Sweden	Europe

• Gene Location: Start: 19619; End: 22399 Strand: -

Full Sequence      

MMRKFTTLLFVALCICLRAQTQVFPEKKFYHSDRVRYDENCFFLEGKPVFILSAAFHYFR
APQELWRDRFQKIKEAGFNTVETYVPWNWHERNMPENVNDLSQFDFSDLKAWLKMAHEEF
GLYTIVRPGPFICAEWAGGAYPRWLAKFCPEKYETSFWLRSNHPEHIKWAKHWYDAVCPV
FAEEQLSRKKKGERGIIMVQLENEYVYFGMESEKKIEFLKALAASCLAHGIDVPLFTCVT
PEVRGSKDDVIGQLFDMDNQYVWWNMHEAKSRIEDLKRVQPNAPAFVCELQGGWFSTVGG
GLSEDSYLDGRHARGMALMAMAGGATGLNYYMFFGGTHFAGWGARRMTTTYDYGAPLKEN
GGVGEKYAAVKGIGELVDRFGKQIAESEAVTFKTDITPEQLTVGVRQASDGTRFLFFFNR
DRKNPFQGKVGLTLPGGEQLSVACELAPADSRMLVLEKDVKEASGGEWYPREQQLPRRPA
VLPASIRIQTAEKRDEDFRGKWQKLPEGLSLPEIDVNDCRYSMYRSRFRLTPQEVSSYGT
LVCEMFTGDPLYVEVNGRLVARVSTDELDNTFDLNGVLKAGTNEVVMVYENRGHAHGYRP
MEELSGMKRAGLGKKQSSIVPVEEWEVKEITQEGQGISRILSSSAGWERIRLDRATVANL
ATLQIAGLEKPQWPAAWVLQGKTGTAVYRTTLEYTPEMIAEEKTVLEFGCVDDAGTLWVN
GRQVASHNAWDKPFVVNIASYIRPGKNEIAIVVRNHSGAGGLLKGVRLLRELKILKPLVW
EVSADMGGVVQGIHEGNRQGDWRVVSLDTRSEIKRKGNHIQPKGERDALFTWYRVTFEMP
EQEKGTWIPWRLLMSASGSGYMWLNGHNIGRHWEEGPQREFYLPECWLNFGGKNTLVFGL
RQSETHGALLRAIEIAPYAQDAEIKD

Enzyme Prediction     

No EC number prediction in MGYG000000322_01870.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	42	373	1.5e-94	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	2.47e-76	42	371	2	312	Glycosyl hydrolases family 35.
PLN03059	PLN03059	5.05e-35	35	727	30	658	beta-galactosidase; Provisional
COG1874	GanA	7.05e-25	35	205	1	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	3.67e-09	643	757	20	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02449	Glyco_hydro_42	6.07e-07	62	205	8	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU07680.1	0.0	2	925	1	921
QRP57068.1	0.0	2	923	1	920
ASM65763.1	0.0	2	923	1	920
QQT77688.1	0.0	2	923	1	920
QCQ49125.1	0.0	11	923	14	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	1.06e-39	34	375	17	337	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	1.89e-39	35	373	11	330	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.36e-39	35	373	35	354	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	5.62e-39	35	373	35	354	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
7KDV_A	3.66e-38	34	386	17	346	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R7P4	3.95e-40	35	373	34	353	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
P16278	1.28e-38	35	373	34	353	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q60HF6	3.18e-38	35	373	34	353	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q58D55	5.87e-38	34	382	32	358	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q9TRY9	2.13e-37	35	382	35	360	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000191	0.999206	0.000179	0.000146	0.000134	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000322_01870.