CAZyme Information: MGYG000000322_02760

Basic Information

• Species: Odoribacter sp900544025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900544025
• CAZyme ID: MGYG000000322_02760
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
151		17055.58	9.6703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000322	3470887	MAG	Sweden	Europe

• Gene Location: Start: 4948; End: 5403 Strand: +

Full Sequence      

MTKKDFITKYLPLAQKAGEAFRINPVVILAQAAIETGWAQSDLCLLHHNFFGITAYGKKN
VWWTGTSVQLSTNSLSFRTYPDPLHSFMDYARLIRHAYTDAADVSYQPAAFALKIGYSKY
ISEVNGDNREAYRRMLVSISRTIEKLIGPSL

Enzyme Prediction     

No EC number prediction in MGYG000000322_02760.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	12	139	1.6e-22	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	5.89e-21	12	90	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	8.96e-21	6	118	46	166	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	9.36e-16	4	117	153	280	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	2.27e-15	1	117	158	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK12711	flgJ	3.06e-12	2	126	214	356	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49904.1	5.02e-70	5	146	7	148
QUT48008.1	6.25e-65	1	147	1	147
ABR43268.1	2.23e-60	6	148	6	148
QRO16544.1	2.23e-60	6	148	6	148
AST53983.1	3.16e-60	6	148	6	148

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	2.40e-07	1	148	1	168	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	3.81e-07	1	148	1	153	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I4P4	1.90e-09	5	144	241	386	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	5.88e-07	4	94	161	260	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	1.13e-06	2	103	160	272	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000016	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000322_02760.