CAZyme Information: MGYG000000323_00928

Basic Information

• Species: Enterococcus_D sp002850555
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D sp002850555
• CAZyme ID: MGYG000000323_00928
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000323_2|CGC6	43160.27	4.8779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000323	3361404	MAG	Sweden	Europe

• Gene Location: Start: 347643; End: 348764 Strand: +

Full Sequence      

MKNYSEIALNTLFERYDYLCKEKIYHGKWSYDIGVVLQGVKEAYEQTGDKRYFDYIQNTM
DFYIDEDGRIKNYQMDAMNIDYINNGKCLFLLYKETGVSKYKIALDTLYQQLQQMPRTSE
GGFWHKKIYPYQMWLDGLYMGAPFLTEYALKFEKAEALEDVIKQFTLCFTHTLDPKTGLL
YHAWDEQKVQPWADPETGCSKNFWGRSMGWFMMALADTMVLLGESEQKNSLENMFVSCLE
ALAKVRDPQKKVWYQVLDKGSERGNYLEASASSMICYATAKAVKAGIIDQKWQVFAQETY
QGLLDEFVFLTKEGWLNLIRNCEVAGLGGPDNRDGTFVYYISEPVITNDFKGYGAFLQAS
LLLQPLTEEGSKK

Enzyme Prediction     

No EC number prediction in MGYG000000323_00928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	25	361	2.6e-107	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.63e-107	1	366	8	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.85e-98	28	361	26	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF73249.1	7.48e-285	1	373	1	373
QGN29886.1	3.98e-280	1	373	1	373
EEV39837.2	1.89e-278	1	373	1	373
QOG31227.1	9.00e-277	1	373	1	373
AMG50372.1	9.00e-277	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	6.69e-125	1	360	1	355	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.06e-83	4	372	16	373	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.28e-82	4	372	6	363	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.46e-15	30	359	81	406	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	6.41e-15	29	304	65	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.68e-82	4	372	16	373	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.22e-37	140	363	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.22e-37	140	363	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000323_00928.