CAZyme Information: MGYG000000323_00931

Basic Information

• Species: Enterococcus_D sp002850555
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D sp002850555
• CAZyme ID: MGYG000000323_00931
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000000323_2|CGC6	34241.91	6.956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000323	3361404	MAG	Sweden	Europe

• Gene Location: Start: 350925; End: 351842 Strand: +

Full Sequence      

MDRISKTAPPIKLKVSKDPQKGDFTSIQAAVMAAEALNAPCEITIASGVYQEQVKIYKNQ
LTLIAEPNTFLCYHLAAEQTDENGQKRGTFQTATLFINGREVFVKNLTIINDAGYGQAVG
QAVAVYIEGDDIRFEHCHLDAFQDTLCLGPLPKYTKEGEPMNSPWRKTIFDQQQSWFLHC
RISGTVDFIFGGGSAIFEECRLHCKNTLQTNYITAASTSKQASGLTFDRCRVTGDKVYYL
GRPWRNDAKVTFLSCCFDQQLVPCGWSDWGKAASHQTVAFTERMCCYQRSPQRPEWVTIE
GVIEK

Enzyme Prediction     

No EC number prediction in MGYG000000323_00931.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	15	296	6.2e-70	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02682	PLN02682	3.39e-44	6	285	64	330	pectinesterase family protein
PLN02773	PLN02773	1.50e-40	13	285	7	265	pectinesterase
COG4677	PemB	2.58e-40	8	272	78	361	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.05e-40	15	269	4	245	Pectinesterase.
PLN02665	PLN02665	1.13e-36	8	285	65	323	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF73252.1	1.38e-223	1	305	1	305
EEV39840.1	5.62e-223	1	305	1	305
AYJ45554.1	1.88e-221	1	305	1	305
AMG50375.1	5.39e-221	1	305	1	305
AUJ85241.1	5.39e-221	1	305	1	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	5.59e-24	15	244	35	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.43e-22	15	280	8	294	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	3.67e-22	22	284	13	263	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	9.90e-22	22	282	17	265	Pectinmethylesterase from Carrot [Daucus carota]
5C1C_A	1.16e-18	7	274	5	253	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.12e-31	13	285	7	265	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	9.88e-31	5	285	77	344	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q42920	8.26e-29	22	282	140	387	Pectinesterase/pectinesterase inhibitor OS=Medicago sativa OX=3879 PE=2 SV=1
Q8GXA1	8.73e-27	22	300	266	535	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9ZQA3	2.34e-26	22	285	99	348	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000323_00931.