CAZyme Information: MGYG000000323_02138

Basic Information

• Species: Enterococcus_D sp002850555
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D sp002850555
• CAZyme ID: MGYG000000323_02138
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000000323_6|CGC2	54285.87	4.8646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000323	3361404	MAG	Sweden	Europe

• Gene Location: Start: 90066; End: 91496 Strand: +

Full Sequence      

MSFPKHFLWGGASAANQYEGGYNEGGKGLACADLISGGSHTTSRKITAKIEEELLYPSHE
ATDFYHHYQEDIALFAEAGFKAFRMSINWTRIFPKGNDAEPNEEGLAFYDRVFDECRQYG
IEPIVTIAHFDVPAYLSQEYNGWVSREVIDFYARYAAVLFERYHEKVNYWITFNEINTAT
LSIGNFLSLGLQVGESEFINQPDNLQQRYQALHHQFVASAKVVAYGQEHYPDLKIGCMIS
YMPRYPYTSHPNDVLLAKQEENMHSKFCGDVQVTGKYPYYAKKYFADHGFAIEFAPEDQA
ILAKGTVDYYTFSYYLTLCVSADEKVTKNGHSMIGGSGVNNPYLEQTEWNAMIDPVGLRI
ALNDIYDRYQLPLMIVENGIGVSETVAKDGQIHDDYRIDYLEKHIAEMEKAIDDGVELIG
YTIWSAVDIVSASTGEMKKRYGIIFVDKYDDGTGTLDRKKKDSFYWYQKVIERNGL

Enzyme Prediction     

No EC number prediction in MGYG000000323_02138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	475	2.3e-146	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	475	2	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	475	3	470	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	475	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	475	4	474	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.02e-177	1	475	4	474	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG51373.2	0.0	1	476	1	476
AUJ86306.1	0.0	1	476	1	476
ASV95938.1	1.47e-308	1	475	1	475
QPQ28248.1	5.73e-306	1	475	1	475
QCJ64326.1	8.13e-306	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.58e-171	3	475	8	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	9.65e-168	1	475	6	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.26e-166	4	475	8	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	9.29e-166	4	475	8	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	4.45e-164	2	475	10	477	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	9.91e-175	2	475	3	476	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	7.04e-170	3	475	8	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	5.28e-167	1	475	6	476	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	4.94e-166	1	475	5	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.17e-159	3	475	4	470	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000323_02138.