CAZyme Information: MGYG000000323_03115

Basic Information

• Species: Enterococcus_D sp002850555
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D sp002850555
• CAZyme ID: MGYG000000323_03115
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000000323_15|CGC1	56043.24	4.9083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000323	3361404	MAG	Sweden	Europe

• Gene Location: Start: 14505; End: 15920 Strand: +

Full Sequence      

MVKIPETFILGAASSAWQTEGWQGKKEGQDSYLDRWYKEERFVWHNGYGPAVATNFMEKF
SEDIQLMQEVHLTHYRTSINWARFFTDHEQLIVDEDYAAHIDQLIDQLLAAGVEPMLCLE
HYELPASLMDAYDGWSSRKVVDLYTRYAEIAFERYGDRVKHWFTFNEPIVIQTRCYLDAI
RWPHEQNTKKWMLWNYHKVLASAQAVAAYHEKGYEGRIGCVLNPEMVYARSSSPEDQNAQ
KMYDLFFNRIFFDPMVKGHYPEELITLCQTYGIYFDPTEEDLETIRTHTVDFLGVNQYYP
KRVRAPRYQWHSDTPFHPEMFYETFDLPGKQMNNSRGWEIYPKVMYDMANYLKENYGNIP
WLITENGMGRENEEQYMDATGQVQDDYRIQFITEHLYWLLKAVEEGANCEGYMLWAFTDC
VSPMNAFKNRYGLVRIELNEERTRSLKKSAAWYRSLIDERWLPFEEKPLIL

Enzyme Prediction     

No EC number prediction in MGYG000000323_03115.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	459	3.2e-123	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.11e-151	1	460	1	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.71e-114	5	461	6	452	Glycosyl hydrolase family 1.
PRK13511	PRK13511	9.02e-79	1	463	2	469	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	1.41e-64	1	457	1	469	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.80e-60	2	457	4	470	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG50034.1	0.0	1	471	1	471
QGN30358.1	0.0	1	471	1	471
ATF72895.1	0.0	1	471	1	471
AYJ45185.1	0.0	1	471	1	471
QOG31649.1	0.0	1	471	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NAV_A	2.09e-128	1	456	17	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	4.19e-128	1	456	17	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5FOO_A	1.24e-119	1	456	1	456	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
4B3K_A	2.41e-119	5	456	4	455	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
6Z1H_A	2.81e-84	2	465	9	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	6.27e-127	3	458	8	461	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
Q75I93	7.62e-69	5	457	44	502	Beta-glucosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU7 PE=1 SV=1
P26208	7.33e-64	2	457	4	443	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q75I94	2.96e-62	5	457	51	509	Beta-glucosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU8 PE=1 SV=1
P22505	1.62e-61	5	457	9	443	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000323_03115.