CAZyme Information: MGYG000000327_01469

Basic Information

• Species: Collinsella sp900540985
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900540985
• CAZyme ID: MGYG000000327_01469
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		28809.71	6.2672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000327	1681373	MAG	Sweden	Europe

• Gene Location: Start: 133; End: 918 Strand: -

Full Sequence      

MSESIYTLRVSRVAAGAYPTISDALAAADQLYPDAEQPVMIRVDPGEYRERVEIHRSHVT
IEGETADSVRIVGSLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIENDAGDG
REVGQAIALYADGDRLVVDACCITGRQDTLFLGPLPPHEAKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVMAGLKASRTDLCFMVVRLQLR
MAWRRIRSTWAVLGANGRKLR

Enzyme Prediction     

No EC number prediction in MGYG000000327_01469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	234	3.4e-52	0.6597222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	6.32e-46	6	221	81	298	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PRK10531	PRK10531	2.97e-30	10	221	84	315	putative acyl-CoA thioester hydrolase.
pfam01095	Pectinesterase	2.71e-29	13	208	4	167	Pectinesterase.
PLN02773	PLN02773	7.85e-29	8	206	7	180	pectinesterase
PLN02682	PLN02682	3.93e-28	6	212	69	252	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	4.33e-147	1	221	1	221
ATP54718.1	2.28e-115	1	221	1	221
QUC03567.1	1.91e-75	8	221	7	216
QIX89293.1	6.11e-62	8	221	17	223
QRP39805.1	8.86e-62	8	221	18	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	1.07e-17	18	230	18	214	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	5.35e-16	18	221	44	234	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	5.87e-16	16	208	17	178	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.10e-15	16	208	17	178	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1XG2_A	2.17e-14	10	206	7	168	ChainA, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	7.65e-19	10	206	260	422	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	2.61e-18	8	206	7	180	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
B8NPS7	1.91e-17	16	235	42	225	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
Q2UBD9	1.91e-17	16	235	42	225	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
Q9LXD9	2.10e-17	18	206	251	406	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000327_01469.