CAZyme Information: MGYG000000328_00974

Basic Information

• Species: CAG-272 sp900556615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-272; CAG-272 sp900556615
• CAZyme ID: MGYG000000328_00974
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440		49515.66	5.4771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000328	1880403	MAG	Sweden	Europe

• Gene Location: Start: 1668; End: 2990 Strand: +

Full Sequence      

MKITFMGAGSTVFVRNIIGDCLCSEALRDSEFALYDIDPIRLSESADILGKMNESMGKHG
KITSYLGVENRKAALKGADFVVNAIQVGGYEPCTVIDFEIPKKYGLRQTIADTLGIGGIM
RALRTIPVVEGFADDMNEVCPDAWFLNYVNPMAMLTGYIQRYAFPHTVGLCHSVQCCSST
VLDEVGMGEYKEGRKELIAGINHMAWLLEIKDKNGNDLYPEIRRRAKEKLLTDKEFKDQI
RFTYIDRLGYYCTESSEHNSEYNNWFIKSKYPELIERHNIPLDEYPRRCVNQIAAWKEEH
EKLKEGTVKPHNRSGEYGSYIMESIVTGTPYKIGGNVLNTGHLISDFPEEACVEVPCLVD
GTGVHPTRVGKLPVQCAALNMTNINTQLMTIEAARSHKRSDVYLAAMLDPHTSSELDIDT
IVKMVDELIEAHGEYLPRFI

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	2	180	6.3e-63	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	1	429	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	1	439	2	430	alpha-galactosidase; Provisional
COG1486	CelF	2.08e-166	1	439	4	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	2.70e-68	2	187	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	6.24e-65	1	436	1	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU55398.1	5.43e-243	1	439	2	439
QQR30630.1	5.43e-243	1	439	2	439
ASB41366.1	5.43e-243	1	439	2	439
ACL77714.1	3.58e-225	1	439	2	440
AEY68140.1	4.82e-223	1	439	2	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	3.51e-31	1	439	5	437	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3FEF_A	3.08e-27	1	410	6	419	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	4.20e-27	1	439	8	440	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	5.04e-25	2	438	30	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	1.80e-24	2	438	8	441	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34645	4.44e-177	2	439	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
P06720	6.43e-139	2	440	6	449	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	9.61e-136	2	440	6	449	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
Q9X4Y0	3.19e-64	2	439	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
A9KTB9	1.28e-40	1	438	11	462	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000328_00974.