CAZyme Information: MGYG000000330_00354

Basic Information

• Species: Lentilactobacillus parabuchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parabuchneri
• CAZyme ID: MGYG000000330_00354
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	MGYG000000330_2|CGC2	69067.61	5.0967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000330	2487416	MAG	Sweden	Europe

• Gene Location: Start: 25403; End: 27214 Strand: +

Full Sequence      

MLYPLTTPSRTLLDLSGLWKFMIDEETTPIDPKKPLPTEDVVSVPASFNDQTASKKIREH
NGFVWYETSFDIAKPLASQRLVLRFGSATHEAWVYLNGQEITHHKGGFTPFEVEINDYLV
ANDNRLTVKLSNILDYTTLPVGNYSETTDASGHKIRHVDENFDFFNYAGLQRPVKIYSTP
TSYINDITVVPNVDLENSRADVQVKVATEGEFDDVKVTILDQDGKPVVSGHSADQTLTIN
DVHLWQPMHAYLYRARVEGLKNGQVIDSYTEEFGVRKVEVKNAQFLINGEPFYFKGFGKH
EDSYVHGRGFNEPTNVLDIHLMKDMGANSFRTSHYPYSEEMMRLCDREGIVVIDETPAVG
LMVSFGFDVSMLESDDYQDDTWTKLKTADAHKQVIKEIIERDKNHACVAMWSIANEAATF
SKGAYEYFKPLFDEARQLDPQNRPCTYTSIMMANPKTDNCVSLVDVIALNRYYGWYVANG
DLATAEKATRDELKAYSDKFPDKPIMYTEYGADTIPGLHSNYDEPFSEEFQEDYYRMTSK
VFDEIPHFVGEQLWNFADFQTKSGIQRVQGNKKGIFTRSREPKMVVRYLKKRWTNIPDFG
YKK

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	591	6.8e-108	0.6117021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	0.0	1	603	1	602	beta-D-glucuronidase; Provisional
COG3250	LacZ	2.78e-116	1	595	1	597	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	4.09e-84	278	596	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	9.33e-37	66	440	113	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.31e-35	86	416	148	462	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APR07752.1	0.0	1	603	1	603
QOP49798.1	0.0	1	603	1	603
QOJ84270.1	0.0	1	603	1	603
QUX06201.1	0.0	1	603	1	603
AEB74096.1	0.0	1	603	1	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JKM_A	3.77e-248	1	603	4	602	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
4JKK_A	2.59e-226	1	603	4	598	CrystalStructure of Streptococcus agalactiae beta-glucuronidase in space group I222 [Streptococcus agalactiae 2603V/R],4JKL_A Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R],4JKL_B Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R]
6D4O_A	3.34e-207	1	602	4	612	Eubacteriumeligens beta-glucuronidase bound to an amoxapine-glucuronide conjugate [Lachnospira eligens]
6BO6_A	4.27e-207	1	602	1	609	Eubacteriumeligens beta-glucuronidase bound to UNC4917 glucuronic acid conjugate [[Eubacterium] eligens ATCC 27750]
6BJQ_A	9.32e-207	1	602	25	633	ChainA, Glycoside Hydrolase Family 2 candidate b-glucuronidase [[Eubacterium] eligens ATCC 27750]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	2.40e-175	1	602	1	596	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
O18835	4.14e-140	1	598	27	630	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
O97524	1.64e-139	1	598	27	630	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
Q4FAT7	5.22e-135	1	598	28	631	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
P08236	1.01e-134	1	598	27	631	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000330_00354.