CAZyme Information: MGYG000000330_00400

Basic Information

• Species: Lentilactobacillus parabuchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parabuchneri
• CAZyme ID: MGYG000000330_00400
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		34436.66	9.9155

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000330	2487416	MAG	Sweden	Europe

• Gene Location: Start: 80632; End: 81555 Strand: +

Full Sequence      

MGALNKKVRIMILSVLTVILSISFFGGVKASASTTIIPDISEWQGKLTSTQVSNLKGQVS
FIINRRQYGANYQDKYATNNTNLYDQYGIPFGEYDYATFTSAASARNEANVFYQHSNKDA
KFYVLDYEENDVTSGTTNAAVKAWYNQMRSLTSKKLVFYSYQSFATAHANTARKSFDAQW
IANYSSRPTIQTDLWQYTNKKYVPALKESVDASTILNSSKPITWWIGGAQSEDVAQPTYF
TDVVTSVKALKKIYLYDSTSFKKANRVVKVNAGTKVAVSSVHKRASGSYYFETADGRYLT
ANKNYVQ

Enzyme Prediction     

No EC number prediction in MGYG000000330_00400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	39	204	2.5e-31	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	2.22e-60	37	215	2	177	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	5.74e-23	37	211	2	182	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam19087	DUF5776	1.13e-15	239	306	1	67	Domain of unknown function (DUF5776). Presumed stalk domain found in bacterial surface proteins forming tandem repeats with high sequence identity. This domain is also associated with other known bacterial surface protein stalks and adhesive domains.
pfam01183	Glyco_hydro_25	1.78e-15	39	204	2	178	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	4.37e-15	39	213	4	190	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOP49754.1	6.30e-221	1	307	1	307
APR07801.1	6.30e-221	1	307	1	307
QOJ84313.1	6.30e-221	1	307	1	307
AFS00875.1	1.47e-194	1	307	1	307
AEB74048.1	1.71e-193	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JZ5_A	1.36e-21	29	220	17	221	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]
2NW0_A	8.96e-21	37	227	3	185	ChainA, PlyB [Bacteriophage sp.],2NW0_B Chain B, PlyB [Bacteriophage sp.]
3HMC_A	2.57e-20	37	229	7	192	Endolysinfrom Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000399	0.998718	0.000352	0.000196	0.000149	0.000141

TMHMM  Annotations     

start	end
12	34