CAZyme Information: MGYG000000330_00724

Basic Information

• Species: Lentilactobacillus parabuchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parabuchneri
• CAZyme ID: MGYG000000330_00724
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	MGYG000000330_3|CGC2	86033.57	6.5216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000330	2487416	MAG	Sweden	Europe

• Gene Location: Start: 162764; End: 165148 Strand: +

Full Sequence      

MQTIQDKLTELTPEELISLTSGADFWKSVAIPEKQIPSFRMSDGPNGLRYQASEGDALGI
NESAISTCFPTASAVACTWDPDLVSEMGQAIGLEARSLNVDMVLGPGINIKRNPLCGRNF
EYFSEDPYLAGMIGAAWIKSLQSKGAAACLKHFAGNNQENDRLLSDSLIDPTALHEMYLE
AFRIAVQTAQPEGIMCSYNKINGTYSSDNDYLLTEMLRNQWGFKGAVITDWGALNNKVAS
INAGTDLEMPTSRGMFDPEAVKALKDGHLKRSAVNRAAGNVIRIAETKRPAFKGDRTTLL
KDNGELAQRIEENAAVLLKNDDQILPISTSEKILVVGQMAVDTRYQGAGSSHINPPSHTS
ILQGLDKAKIAYDYQQGYGFSNSNTGALTEAAIAAAKNAKTVVFVAGLPESDESEGFDRQ
NMNLPANQNALIERLAAVNPNLIVLLVAGAPTELPWLSKVKGLINLYLGGQFVGDAVARI
LAGAVNPSGKLAESYPISYQDVASADIYDRNPRSVGYAESVYVGYRYYEKADQPVAFPFG
YGQSYTTFQLSDPSLSGTEIQTGQSIEVTVTVANTGDRDGAEVVQVYVGNSPKRALKPLK
ELKGFQKVFLKAGERKRVTISLSDHAFSEWNDASQSWQLPAAEKFVIVGTSSAQTLPPLS
VKANGQSVPSDKNLPSWYVKPTGKPNLADFSKMSGLTVQPFVTTQPGQYTRLNTPRELGA
HSIIVRKIANIVKKNMTKDIPDPNSPEAKFMETIVMDTPLIRLAQQSAGKLSLALVDKLV
AVANRHYVKAAFGR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	250	1.6e-69	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.69e-88	67	655	118	757	beta-glucosidase BglX.
COG1472	BglX	8.29e-71	24	368	48	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.09e-53	30	622	75	742	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	9.90e-52	315	525	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.77e-38	67	284	86	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APR07262.1	0.0	1	794	1	794
QOP50238.1	0.0	1	794	1	794
QOJ85957.1	0.0	1	794	1	794
AFS01006.1	0.0	1	792	1	792
QUX06282.1	0.0	1	792	1	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	7.46e-190	4	664	5	669	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.97e-170	8	683	9	687	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.97e-118	1	652	1	702	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.45e-117	1	652	1	702	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.74e-106	4	656	6	829	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.08e-189	4	664	5	669	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.51e-170	10	665	11	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.30e-169	10	665	11	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.43e-119	4	652	46	735	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
A1CA51	2.31e-115	4	644	6	808	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.772287	0.226513	0.000532	0.000234	0.000162	0.000276

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000330_00724.