CAZyme Information: MGYG000000330_00755

Basic Information

• Species: Lentilactobacillus parabuchneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus parabuchneri
• CAZyme ID: MGYG000000330_00755
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000000330_4|CGC1	28178.87	8.621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000330	2487416	MAG	Sweden	Europe

• Gene Location: Start: 11539; End: 12318 Strand: -

Full Sequence      

MMKALAAAIAVIGFCFVQANIANASVETDFINRLKDPVVKVSKQNHLYPSVMMAQAIVES
DFGRSELSLDANNYFGVKGSYNGQSVTMSTGEYTANGKHYMTAAAFKKYPTIEASIKDNA
YLLRHGTLTDSNYYSGTWTSNAPTSSDAAMALSLTYATDMEYGNKLNAIIVKYDLNKLDG
SVSSGDINSKIDASLDKQLAGNKKQEAEVRAENAQSKINSIPKRIIPNFVFNTKGATKIN
QGDPVIQFNSLPLQNIVEK

Enzyme Prediction     

No EC number prediction in MGYG000000330_00755.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	38	175	5.8e-28	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.70e-45	19	185	36	194	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.61e-38	20	179	313	472	amidase domain-containing protein.
PRK06347	PRK06347	1.14e-37	22	185	146	309	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	2.85e-28	29	180	10	145	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	5.27e-21	35	118	1	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APR08225.1	6.08e-179	1	259	1	259
QOJ84708.1	6.08e-179	1	259	1	259
QOP51469.1	6.08e-179	1	259	1	259
QUX05738.1	1.10e-149	1	259	1	259
AFS00453.1	1.57e-149	1	259	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.34e-38	30	179	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.05e-27	18	179	51	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RHZ5	1.24e-30	30	188	65	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	4.58e-30	30	188	65	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	8.99e-30	30	189	65	224	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P37710	2.45e-28	28	186	181	340	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	1.05e-27	30	183	65	218	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999111	0.000166	0.000172	0.000161	0.000144

TMHMM  Annotations     

start	end
4	26